PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA36730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YB
Protein Properties Length: 194aa    MW: 21677.3 Da    PI: 5.2606
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA36730genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1681.2e-52599296
                      NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87
                               reqd+++Pianv+rim+++lP +akis+daket+qecvse+isf+tsea+++cq+e+rkt++++d+lwa+++lGf+dyv+pl  yl
  Tp57577_TGAC_v2_mRNA36730  5 REQDQYMPIANVIRIMRRILPPHAKISDDAKETIQECVSEYISFITSEANERCQKEQRKTVTAEDILWAMGKLGFDDYVNPLAFYL 90
                               89************************************************************************************ PP

                      NF-YB 88 kkyrelege 96
                               ++yre ege
  Tp57577_TGAC_v2_mRNA36730 91 QRYRESEGE 99
                               ******997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.9E-483106IPR009072Histone-fold
SuperFamilySSF471134.35E-377106IPR009072Histone-fold
PfamPF008081.7E-261074IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.6E-163856No hitNo description
PROSITE patternPS0068504157IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.6E-165775No hitNo description
PRINTSPR006155.6E-167694No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MAGIREQDQY MPIANVIRIM RRILPPHAKI SDDAKETIQE CVSEYISFIT SEANERCQKE  60
QRKTVTAEDI LWAMGKLGFD DYVNPLAFYL QRYRESEGEP ASVRRTSSHA VPHPPLPLSM  120
LQQQQQLPFL SAMPVSSIDG NNNCYGFGYG FDFDQGFYRD GVGGGGDASS SAAAFVPNFD  180
HCFPHLKRDN SNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-40595393NF-YB
4awl_B4e-40595494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-40595494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182831e-120JQ918283.1 Medicago truncatula nuclear trancription factor Y subunit B10 (NF-YB10) mRNA, complete cds.
GenBankAC1517091e-120AC151709.9 Medicago truncatula clone mth2-31g22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004498102.12e-98PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotQ84W661e-56NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLG7ICG42e-97G7ICG4_MEDTR; Ccaat-box-binding factor HAP3-like protein
STRINGGLYMA20G00240.14e-71(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.24e-58nuclear factor Y, subunit B6