PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA35974
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 434aa    MW: 48082.9 Da    PI: 7.4368
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA35974genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.76.2e-39102161261
                     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                ++k+++cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvP+G+grrknk+ 
  Tp57577_TGAC_v2_mRNA35974 102 PDKIVQCPRCKSWDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPIGAGRRKNKHL 161
                                7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2896159IPR003851Zinc finger, Dof-type
PfamPF027012.2E-31104160IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.922106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MNMSETEKNP GIRLFGWKIP VPECQIPTNS GPMDTCSSTK KTEVEILCAE KSEQQDNSSD  60
SMDSKQETHH DMQEKEPIVN SKSADDNTES GNTDDEKILK KPDKIVQCPR CKSWDTKFCY  120
FNNYNVNQPR HFCKNCQRYW TAGGTMRNVP IGAGRRKNKH LASQYRQIIV TSDGIPTSRL  180
ETIPSSTHHT STDNETVLKF GPDTPLCESM ESMLHLKDQK RSSDANSISC VQHREEPSLY  240
GSSVTNTNTQ XXXXXXXXEH NASNWLQCYP VPPWVLPMNP GWNMNNVASM AAVHPTSASM  300
CNPYSVAPTT MQWCPTPMLA IPGIRPQNIP LQLVPASNWS RPSLCLSPPS STSNSCCTGN  360
GSQTLGKHTR DTVFTDQDKS DKSVPVRKTI RINVTNEGPI SPIRATLANK TPTQILEANS  420
AAISHAHTIQ ESI*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003624725.20.0Dof zinc finger DOF5.2-like protein
TrEMBLA2Q4B20.0A2Q4B2_MEDTR; Dof zinc finger DOF5.2-like protein
STRINGGLYMA19G29610.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-45cycling DOF factor 2