PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA35786
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 243aa    MW: 27245.6 Da    PI: 9.2438
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA35786genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.32.6e-43461451100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk++rrkC+++C++apyfp ++p+kfa+vhk+FGasnv kll++++ ++reda++sl+yeAear+rdPvyG+vg+i++lq
  Tp57577_TGAC_v2_mRNA35786  46 PCAACKIQRRKCTQECIFAPYFPPDNPQKFAYVHKVFGASNVAKLLNEVNISQREDAVKSLAYEAEARLRDPVYGCVGLISHLQ 129
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                 +l+ l++el+ +k+e
  Tp57577_TGAC_v2_mRNA35786 130 TKLRDLQNELVNAKKE 145
                                ***********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.98445146IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-4346143IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
LQQHIQITNK STTITISFSL HQHNNNNIVF SGTTITIMSS WNNNSPCAAC KIQRRKCTQE  60
CIFAPYFPPD NPQKFAYVHK VFGASNVAKL LNEVNISQRE DAVKSLAYEA EARLRDPVYG  120
CVGLISHLQT KLRDLQNELV NAKKELASFH SPPQPPLLLP PAAATGSSYF SFGSSSAQQR  180
HHEIFNFSGN NNNINNSFSS FQMHPFQNQL MISSSSSSQP QTQIHNQFFS KKMLKEERQN  240
LD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013460833.12e-78LOB domain protein
TrEMBLA0A072UZB62e-78A0A072UZB6_MEDTR; LOB domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-56ASYMMETRIC LEAVES 2-like 1