PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA35565
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 279aa    MW: 30332.6 Da    PI: 10.1188
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA35565genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.76.2e-3973133262
                     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                +e++lkcprCdstntkfCy+nnysl+qPr+fCkaCrryWt+GGalrnvPvGgg+r+n+k++
  Tp57577_TGAC_v2_mRNA35565  73 PEQQLKCPRCDSTNTKFCYFNNYSLTQPRHFCKACRRYWTRGGALRNVPVGGGCRRNNKKN 133
                                6899****************************************************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3257126IPR003851Zinc finger, Dof-type
PfamPF027011.9E-3275131IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.47877131IPR003851Zinc finger, Dof-type
PROSITE patternPS01361079115IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MIFSSIQGYV DPPNWHNQQP NQHQQNGSDN IQLLPPLPPQ VGGSTGASGG GTMGSIRPSS  60
MAERARSAKL PPPEQQLKCP RCDSTNTKFC YFNNYSLTQP RHFCKACRRY WTRGGALRNV  120
PVGGGCRRNN KKNKRSRSKS PNSTNSHEKQ TSSSSAIPSH HELIGHQLPQ TITNLPFMAS  180
MQNHLSRYVV GNVNMGLGLR EIQEQQQQTD HMGFQIGVGN GNGNSSVTVS AAAAGGGVGV  240
DQWRNLQQFP FLNTFESTSG GNNSFPFQGE SIEATSSGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013456108.11e-148Dof domain zinc finger protein
TrEMBLA0A072UK581e-148A0A072UK58_MEDTR; Dof domain zinc finger protein
STRINGGLYMA11G14920.21e-101(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.19e-42Dof family protein