PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA35439
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 299aa    MW: 32992.5 Da    PI: 9.6662
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA35439genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.85.7e-3972131362
                     zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                e+alkcprC+stntkfCyynny+lsqPr+fCk+CrryWt+GGalrnvPvGgg+r++kk++
  Tp57577_TGAC_v2_mRNA35439  72 ETALKCPRCESTNTKFCYYNNYNLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRSKKTK 131
                                6789****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-2740126IPR003851Zinc finger, Dof-type
PfamPF027015.3E-3374129IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.70275129IPR003851Zinc finger, Dof-type
PROSITE patternPS01361077113IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MVFSSIPSYL DPLNWQQQPN QHQLLPPLSS QPHGAGSIIR PGSLPDQAQV QAQEVQTGQA  60
QAPQGKLPPP SETALKCPRC ESTNTKFCYY NNYNLSQPRH FCKTCRRYWT RGGALRNVPV  120
GGGCRRSKKT KKSTSTTTTP SKSNDKEYST SAIHSTTSNP HGDQFLHPTS RNYLNMSSLQ  180
NLNRFGVGNM FQMGDYSSNT GGGEGGVVDQ WRFQQFPFMN NGFESSSNVS FPFQSEIIEP  240
QTSSRVTTQI PTSIKSEYNG GLNLLRSPLS FSQNNNHYNN SSWTDISGLA TSSTSRLM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013465384.11e-156Dof domain zinc finger protein
TrEMBLA0A072VBP41e-156A0A072VBP4_MEDTR; Dof domain zinc finger protein
STRINGGLYMA12G06880.23e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.31e-36OBF-binding protein 3