PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA35216
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 172aa    MW: 18656.9 Da    PI: 7.5024
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA35216genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.95.5e-46131121100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lq
  Tp57577_TGAC_v2_mRNA35216  13 PCAACKLLRRRCAQDCVFAPYFPADEPHKFANVHKVFGASNVNKMLQDLPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQ 96 
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                qq++ l+++la++++e
  Tp57577_TGAC_v2_mRNA35216  97 QQIDVLQTQLAVAQAE 112
                                ***********99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.86112113IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MKEGNKKQGA ASPCAACKLL RRRCAQDCVF APYFPADEPH KFANVHKVFG ASNVNKMLQD  60
LPEHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID VLQTQLAVAQ AEAVHLRVRQ  120
TASSFWNSAG HSPTSPTYSG SPSSKINESQ AKHIFDMDMV VVDQDGYGGD W*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0907161e-112BT090716.1 Soybean clone JCVI-FLGm-5M9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003607861.11e-114LOB domain protein
SwissprotQ9SHE91e-71LBD4_ARATH; LOB domain-containing protein 4
TrEMBLG7JIR81e-114G7JIR8_MEDTR; LOB domain protein
STRINGGLYMA07G35000.11e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.16e-73LOB domain-containing protein 4