PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA35172
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 466aa    MW: 50478.2 Da    PI: 7.3266
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA35172genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.8e-39116176262
                     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ s
  Tp57577_TGAC_v2_mRNA35172 116 PDKIIPCPRCNSMDTKFCYFNNYNVNQPRHFCKKCQRYWTAGGTMRNVPVGAGRRKNKNLS 176
                                7899******************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-31103173IPR003851Zinc finger, Dof-type
PfamPF027011.0E-31118174IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.481120174IPR003851Zinc finger, Dof-type
PROSITE patternPS013610122158IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MTEVKDPAIK LFGRTIPLPL IIPNDSSSPS SSPPEFSSAI QQETEEPSRK EPATTQDDDA  60
SQQTAEDLKS LTTSSVILEN PPKTPSAETE NSLLKSSTNG EQSETSVSEE KTLKKPDKII  120
PCPRCNSMDT KFCYFNNYNV NQPRHFCKKC QRYWTAGGTM RNVPVGAGRR KNKNLSSSHY  180
RHLIIPEAAK LNSPNGLHMG NGAAVLAFDS GSPLCNTMAS VLNIAERTQN CVPNGFHHPN  240
SYVGESGHSN AVSVTTSTSS ERKGHADTNG PVDKRVEGFP PQLQYIPSPL LPYPWSSAMP  300
PPAFCPPNYP LAFYTPVTPP AYWGCVPPPW NMPCISSESA SVNHSDSAHS SVPYSPTLGK  360
HSRDGNIITS VNSQKEKPDN EHNNTESSVL IPKTLRFDDP NEAAKSSLWS KLGINNDKAS  420
SINGGGMFNG FQSKGKDMNH SVEASPLMYA NPAALSRSRT FQEGT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1400300.0AC140030.6 Medicago truncatula clone mth2-7g24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003607748.10.0DOF-type zinc finger DNA-binding family protein
TrEMBLG7JG960.0G7JG96_MEDTR; DOF-type zinc finger DNA-binding family protein
STRINGGLYMA07G35690.11e-174(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.25e-81cycling DOF factor 2