PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA34763
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 308aa    MW: 33746.9 Da    PI: 8.68
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA34763genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.2e-393999262
                     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                               k++a++cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s+
  Tp57577_TGAC_v2_mRNA34763 39 KDQAINCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRST 99
                               7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-303597IPR003851Zinc finger, Dof-type
PfamPF027019.7E-344097IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1064397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MDTAQWAQGN IGLVKQMDGS TSNSKPPASL IERRARPQKD QAINCPRCNS TNTKFCYYNN  60
YSLSQPRYFC KTCRRYWTEG GSLRNVPVGG GSRKNKRSTS SSSSSPSISQ SQPHQSQPIS  120
SSITKNIIIN PDLTTSTHNH NFPQSASQNP KIHQGQDLNL AYPPQTNEDS YNNTISKFIE  180
LPYSTEQDKT TSAMELLKTA SSSRGLNSFM PMTLSEGSAM YNSSGFALQD FKLGVNFGLE  240
GFENGYGGLQ GINQEGXXXX AAQQQQVPNG GGEFDHQHHH HQQQQNNRNQ GGDASGYWNG  300
MLGGGSW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602283.21e-159Dof-type zinc finger DNA-binding family protein
TrEMBLG7J7H31e-159G7J7H3_MEDTR; Dof-type zinc finger DNA-binding family protein
STRINGGLYMA04G41170.11e-109(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.43e-45Dof family protein