PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA34744
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 495aa    MW: 54646.2 Da    PI: 6.4411
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA34744genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.31.9e-39140200262
                     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                ++k+++cprC s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  Tp57577_TGAC_v2_mRNA34744 140 PDKIIPCPRCRSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKTSS 200
                                7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.6E-32142198IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.621144198IPR003851Zinc finger, Dof-type
PROSITE patternPS013610146182IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-25146197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MLETKDSAIK LFGKTIPVPE ILPALSSGDV VDESIESIHD ENHDSSTNSS RESHNTRDDA  60
HEQEIEKDTS GEKQTDEKNE GVSMQSTGEF TNQDAASGTG EESITVSTER EDATLKTSKT  120
EKEEQQDETS NSQDKILKKP DKIIPCPRCR SMDTKFCYYN NYNVNQPRHF CKNCQRYWTA  180
GGTMRNVPVG AGRRKNKTSS SHYRQITVSE ATLQNSRIHP SLKCNGTILT FGSNTPLCES  240
MSSVLKLADK SVQNYTRNGF RKPEVLRIHV PHASGENGDD QSNKSLITST KSMEVASTNV  300
SQEPGMQNGQ SFSPQGAYFP PGTPWSFPWS QVQWSSSIPP PTFCPPGFSM PFYPPASYWG  360
CTVPGAWNLP WQAQPSSPNG ANPNSSPNSP TLGKHSREDN VLKSSEDSRK ESREEKCLWF  420
PKTLRIDDSG EAEKSSLWTT LGIKNNKADS VSSGRLFNVF PSKCDEPNHL VQASSILQAN  480
PAALTRSLNF RETS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003621247.10.0DOF-type zinc finger DNA-binding family protein
TrEMBLG7L2020.0G7L202_MEDTR; DOF-type zinc finger DNA-binding family protein
STRINGGLYMA18G49520.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.21e-81cycling DOF factor 2