PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA34662
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB_related
Protein Properties Length: 312aa    MW: 34760.5 Da    PI: 8.6509
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA34662genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.21.6e-125498147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Tp57577_TGAC_v2_mRNA34662 54 RENWTEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 98
                               789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.58E-1648104IPR009057Homeodomain-like
PROSITE profilePS5129413.72249103IPR017930Myb domain
TIGRFAMsTIGR015572.9E-1852101IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.0E-652104IPR009057Homeodomain-like
SMARTSM007177.1E-1053101IPR001005SANT/Myb domain
PfamPF002495.2E-105498IPR001005SANT/Myb domain
CDDcd001679.67E-85699No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MVSKNPNPPE GFCLDPNPMA LPGFGPFASV SAAANSSDDA SKKIRKPYTI TKSRENWTEP  60
EHDKFLEALQ LFDRDWKKIE AFIGSKTVIQ IRSHAQKYFL KVQKSGANEH LPPPRPKRKA  120
AHPYPQKASK SAPVLPQVPG SIQSSSALLE PGFILKHESI PMLETPIMNT VVSSWSNHPL  180
QNTNLLQVPT VNNSCSSSES TPKVRPVGES NSQGNKILPL RVLPDFSQVY NFIGSVFDPE  240
ATEHLQKLKQ MNRIDVETVL LLMRNLSINL TSPDFEDHKK LLSSYEVDHE TNNYLNPDRL  300
IHDEHLKSAA T*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA34662
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004516868.10.0protein REVEILLE 6 isoform X1
SwissprotQ8H0W31e-117RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A1S2Z8B40.0A0A1S2Z8B4_CICAR; protein REVEILLE 6 isoform X1
STRINGXP_004516868.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.22e-99MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]