PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA34491
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ARR-B
Protein Properties Length: 569aa    MW: 64528.8 Da    PI: 6.43
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA34491genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like74.71.3e-23199252155
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+ L++e+v+SHLQkYRl
  Tp57577_TGAC_v2_mRNA34491 199 KARVVWSVDLHQKFVKAVNQI-GFDKVGPKKILDLMNVPWLSRENVASHLQKYRL 252
                                68*******************.9*******************************8 PP

2Response_reg81.33.1e-27191271109
                                EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTT CS
               Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahge 82 
                                vl+vdD+p+ +++l+++l+k +y ev+++  ++ al ll+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge
  Tp57577_TGAC_v2_mRNA34491  19 VLVVDDDPTWLKILEKMLKKCNY-EVTTCCLARHALSLLRERKdgYDIVISDVNMPDMDGFKLLEHVGLEM-DLPVIMMSVDGE 100
                                89*********************.***************999999**********************6644.8*********** PP

                                HHHHHHHHHTTESEEEESS--HHHHHH CS
               Response_reg  83 eedalealkaGakdflsKpfdpeelvk 109
                                 + + + ++ Ga d+l Kp+ ++el++
  Tp57577_TGAC_v2_mRNA34491 101 TSRVMKGVQHGACDYLLKPIRMKELRN 127
                                ************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.2E-3515141IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23007.0E-4416152No hitNo description
SMARTSM004481.6E-3117129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.10618133IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.0E-2419128IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.51E-2920133No hitNo description
Gene3DG3DSA:1.10.10.604.5E-27196257IPR009057Homeodomain-like
SuperFamilySSF466891.63E-16197256IPR009057Homeodomain-like
TIGRFAMsTIGR015579.9E-21199252IPR006447Myb domain, plants
PfamPF002493.0E-7201251IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MDNGCFSSPR RDFPNGLRVL VVDDDPTWLK ILEKMLKKCN YEVTTCCLAR HALSLLRERK  60
DGYDIVISDV NMPDMDGFKL LEHVGLEMDL PVIMMSVDGE TSRVMKGVQH GACDYLLKPI  120
RMKELRNIWQ HVFRKRIHEV RDFENFESFE SMHLMTNGSE LSEEGNLFAL EDMTTTKKRK  180
DLDNKHDDKE FLDSSSSKKA RVVWSVDLHQ KFVKAVNQIG FDKVGPKKIL DLMNVPWLSR  240
ENVASHLQKY RLYLSRLQKD NEQKSSPSGM KHSDLPSKDV GNFNFPNSAI KQQNDASIDR  300
CNYSEGTLHH QNMETKSHEG NPKGIVPHST TAEKARPLTG NITDANIQPF ASLESERKHA  360
AFDCTMSTPY SWTDIPKSQL KKEQKPVVHL EDNFNLLPFH GKKHNIQVDQ SQSIASISST  420
PSITEQDVAA CIETKPRFSG YKKDYTSSVS SIRSSVDTFP FRPGNLMMND QPSQPISTTN  480
FGLKTQSSNN LSCISDLESY QRNLLFGGEA ASAAPLDEDL YFYWHNMNFG QPNIGMSEYY  540
DPGLLTEVPN HLYDSADYLV IDQGLFIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-17195257163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA34491
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1405050.0BT140505.1 Medicago truncatula clone JCVI-FLMt-22H12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003601849.10.0two-component response regulator ARR11 isoform X1
TrEMBLA0A2K3NTV00.0A0A2K3NTV0_TRIPR; Two-component response regulator ARR11-like protein
STRINGAES721000.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-122response regulator 11