PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA34400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family HD-ZIP
Protein Properties Length: 285aa    MW: 32374.1 Da    PI: 6.109
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA34400genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.3e-1878131356
                                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Tp57577_TGAC_v2_mRNA34400  78 KKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 131
                                456899***********************************************9 PP

2HD-ZIP_I/II132.91.2e-4277167191
                HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekev 84 
                                ekkrrl+ eqvk+LE+sFe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy++Lkr+yd++k++n++L++++
  Tp57577_TGAC_v2_mRNA34400  77 EKKRRLNMEQVKTLEKSFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDVLKRQYDSIKADNDALQAQN 160
                                69********************************************************************************** PP

                HD-ZIP_I/II  85 eeLreel 91 
                                ++L++e+
  Tp57577_TGAC_v2_mRNA34400 161 QKLQTEI 167
                                ****987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.18E-1972135IPR009057Homeodomain-like
PROSITE profilePS5007117.11973133IPR001356Homeobox domain
SMARTSM003891.8E-1876137IPR001356Homeobox domain
CDDcd000868.78E-1678134No hitNo description
PfamPF000461.6E-1578131IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-1980140IPR009057Homeodomain-like
PRINTSPR000311.1E-5104113IPR000047Helix-turn-helix motif
PROSITE patternPS000270108131IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5113129IPR000047Helix-turn-helix motif
PfamPF021836.1E-17133173IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MAFFPANFML QTSHQEDHHH QPPPSLNSII TSCAPQDYHG GGVSFLGKRS MSFSGIELGE  60
EANVEEELSD DGSQLGEKKR RLNMEQVKTL EKSFELGNKL EPERKMQLAR ALGLQPRQIA  120
IWFQNRRARW KTKQLEKDYD VLKRQYDSIK ADNDALQAQN QKLQTEILAL KSREPTESIN  180
LNKETEGSSS NRSENSSDIK LDISTRTQAI DSPLSTQQTS INLFPSSSRP TGGVPHQLFQ  240
TNSRQDIQCQ KIDHMVKEES LSNMFCAIDE QSGLWPWLEQ QHFN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125133RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA34400
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0519610.0BT051961.1 Medicago truncatula clone MTYF9_FA_FB_FC1G-H-4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013445749.10.0homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-116ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A2K3PNN80.0A0A2K3PNN8_TRIPR; Homeobox-leucine zipper protein ATHB-13-like
STRINGXP_004511225.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-107HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]