PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA34006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 177aa    MW: 19645.2 Da    PI: 5.1606
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA34006genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.94.2e-4471061100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +Ca+Ck+lrr+C+++C++apyfp+++p+kfa+vhk+FGasn++k+l++lp ++r +a++slvyeA+ar+rdPvyG+vg i+ lq
  Tp57577_TGAC_v2_mRNA34006   7 PCASCKLLRRRCTQECIFAPYFPSDDPRKFAIVHKVFGASNISKMLQELPIHQRVEAVNSLVYEANARVRDPVYGCVGAISYLQ 90 
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                +q++ql+ +la++++e
  Tp57577_TGAC_v2_mRNA34006  91 SQVSQLQMQLAVAQAE 106
                                ************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7576107IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGSGSSPCAS CKLLRRRCTQ ECIFAPYFPS DDPRKFAIVH KVFGASNISK MLQELPIHQR  60
VEAVNSLVYE ANARVRDPVY GCVGAISYLQ SQVSQLQMQL AVAQAEILCI QMQQDSATVT  120
DSLPTHVDQD DKFMLLSENN NCYGVLPQYL NFPSSSSSSS NVFQDYEPLK SETFWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU6515811e-135CU651581.9 M.truncatula DNA sequence from clone MTH2-66L10 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003599327.11e-114lateral organ boundaries (LOB) domain protein
SwissprotQ8LBW32e-76LBD12_ARATH; LOB domain-containing protein 12
TrEMBLG7J0R01e-114G7J0R0_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA18G06530.11e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.17e-63LBD family protein