PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA33634
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 374aa    MW: 41167.8 Da    PI: 7.701
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA33634genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.13.5e-37105164261
                     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                ++k+++cprC+s +tkfCy+nny+++qPr+fC++C+ryWt+GG++rnv vG+grrknk+ 
  Tp57577_TGAC_v2_mRNA33634 105 PDKIVQCPRCNSFDTKFCYFNNYNVNQPRHFCRNCHRYWTAGGTMRNVAVGAGRRKNKHI 164
                                7899******************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2793162IPR003851Zinc finger, Dof-type
PfamPF027011.2E-30107163IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.307109163IPR003851Zinc finger, Dof-type
PROSITE patternPS013610111147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MNGEGDMSVK YHKNSSIMLF GKKIPVPEYH TPATSQKGSQ IPANSTTMND CSNSKQTRIE  60
MPHTQNIEKS KNSSKEENES KVTTSTVEDT METSSTDQDK VLKKPDKIVQ CPRCNSFDTK  120
FCYFNNYNVN QPRHFCRNCH RYWTAGGTMR NVAVGAGRRK NKHIGSQYRN MIVASGGTST  180
ANLETNDSIQ HDNGIFLKFG LDVDASANNG MENREESSSL CVSSVTNGYT RGTELSESEQ  240
NRSKPLQSYP ASSWIIPLNQ SWNNVTSMVQ SSMQMYPTTV QWCHAPMVAN IFTPNIGLQF  300
VPGSYGNGNV SIGSNGCISP SSSTTSNSLC SGNGSPILGK HTRDSVLTDE EKPEMEMRVF  360
APKALRIDET NLE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013451513.11e-167Dof zinc finger DOF5.2-like protein
TrEMBLA0A072U8361e-167A0A072U836_MEDTR; Dof zinc finger DOF5.2-like protein
STRINGGLYMA19G29610.21e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.25e-42cycling DOF factor 2