PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA33537
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family M-type_MADS
Protein Properties Length: 347aa    MW: 40288.9 Da    PI: 9.2689
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA33537genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF49.45.8e-161151343
                               --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                     SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                               i+ +  r +tf kR++g++KK eE  +LCd++v++i+++++
  Tp57577_TGAC_v2_mRNA33537 11 IQKEKSRRTTFQKRKKGLIKKVEEFAILCDVDVCLILYAPN 51
                               77788999******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.17161IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-18160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-20295IPR002100Transcription factor, MADS-box
CDDcd002661.84E-21277No hitNo description
PRINTSPR004044.3E-12323IPR002100Transcription factor, MADS-box
PfamPF003192.5E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGRGRISMEL IQKEKSRRTT FQKRKKGLIK KVEEFAILCD VDVCLILYAP NFEGQGYAEP  60
EIWPKEPKVR KILQKYYNTT NDRRPKIYDV QEYYKERMKK VEFEISKVRK EMLKIMYPTW  120
EESFNSLGEE QMRLFAGLLD AKLDACNQKM NMLKGDVKGK RIAHESHKVD KPNIPYLTSN  180
SNTYFNFMPN NMSLPQIYPP LMNIAEKNPF GFWPLHLGQS SQPSSTLSSA QGSNQMESDE  240
GRYAQSYPGK QVDANWTNWT SQIDANISYD PKTGTKKKNG AENDENLLPY YYNGNAMTMQ  300
SYPIGMHTLP FQNLQNLPPH GYQFNGFYDM DILQAHMFNN YMDGRK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11225KEKSRRTTFQKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA33537
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004516685.10.0MADS-box transcription factor 20-like
TrEMBLA0A2K3PBS90.0A0A2K3PBS9_TRIPR; MADS-box transcription factor pheres 2-like protein
STRINGXP_004516685.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.14e-25M-type_MADS family protein