PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA33291
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family GATA
Protein Properties Length: 145aa    MW: 15965 Da    PI: 10.7541
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA33291genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.68.4e-196093134
                       GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                               Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  Tp57577_TGAC_v2_mRNA33291 60 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 93
                               *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577165.23E-1553116No hitNo description
SMARTSM004017.6E-1554108IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.4245490IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.0E-155891IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.66E-1359116No hitNo description
PfamPF003201.1E-166094IPR000679Zinc finger, GATA-type
PROSITE patternPS0034406085IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
LGSXXXXXXX XXXPLLLRPF FPSPPPLVSG EPPAKKQKKK AQAQVGDVEA QGEAHLQRRC  60
SHCQVQKTPQ WRTGPLGAKT LCNACGVRYK SGRLFSEYRP ACSPTFSSEI HSNSHRKVLE  120
MRKRKGMVGP EPGLPAQTQM VRTC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU4439651e-160GU443965.1 Trifolium repens clone BAC 99k01 zinc knuckle (ccHc-type) family proteins, metal ion binding protein, zinc finger (GATA type) family protein, ferredoxin hydrogenase, SH3 domain-containing protein, kinesin-related protein, salt tolerance-like protein, dehydrin b, zinc-mediated transcriptional activator, 26S proteasome AAA-ATPase subunit RPT4a, inositol monophosphatase, dehydrin, and zinc ion binding protein genes, complete cds; and unknown genes.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004500773.16e-65PREDICTED: GATA transcription factor 7
RefseqXP_003603996.28e-65GATA type zinc finger transcription factor family protein
SwissprotQ9FH571e-40GATA5_ARATH; GATA transcription factor 5
TrEMBLD3YBF23e-65D3YBF2_TRIRP; Zinc finger (GATA type) family protein
STRINGGLYMA06G01110.11e-55(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.27e-40GATA transcription factor 5