PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA32786
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YC
Protein Properties Length: 145aa    MW: 16411.9 Da    PI: 5.5681
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA32786genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC135.81.3e-4217923101
                      NF-YC  23 larikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                                larikki+kadedvkmi aeaPvl++kace+fi eltlrsw+h+eenkrrtl+k++iaaa+++tdi+dflvdivp+d+l
  Tp57577_TGAC_v2_mRNA32786   1 LARIKKIMKADEDVKMIFAEAPVLFAKACEMFISELTLRSWNHTEENKRRTLQKNNIAAAIAKTDIYDFLVDIVPHDDL 79 
                                79**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008082.2E-18161IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.103.3E-34175IPR009072Histone-fold
SuperFamilySSF471138.05E-24278IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
LARIKKIMKA DEDVKMIFAE APVLFAKACE MFISELTLRS WNHTEENKRR TLQKNNIAAA  60
IAKTDIYDFL VDIVPHDDLK DEVLASIPRG TMHVGGPADA LPYYYMPPQQ PVVDPNMYAE  120
QPHPFMAPQM WPQPSDQRPP SPDH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_C7e-361761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
4csr_B7e-361761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14854RRTLQKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004494629.11e-85PREDICTED: nuclear transcription factor Y subunit C-3-like
SwissprotQ8L4B21e-56NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
TrEMBLQ2HTM12e-85Q2HTM1_MEDTR; Histone-fold/TFIID-TAF/NF-Y
STRINGGLYMA19G42460.16e-82(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125734108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08970.42e-53nuclear factor Y, subunit C9