PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA32770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ZF-HD
Protein Properties Length: 181aa    MW: 19733.8 Da    PI: 8.0626
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA32770genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer95.64e-301772257
                ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                               +++ Y+eCl+NhAaslG++a+DGCgEf+ ++++ + a++l+CaACgCHRnFHR+ +
  Tp57577_TGAC_v2_mRNA32770 17 QNYIYRECLRNHAASLGSYATDGCGEFTFDDTSPSAASSLQCAACGCHRNFHRKIT 72
                               5789*************************97777*******************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.1E-251971IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.4E-242170IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-172170IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152323.8332171IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466894.66E-1689160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-2793161IPR009057Homeodomain-like
TIGRFAMsTIGR015658.6E-29102160IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MEGGGMLSSS SSSSHSQNYI YRECLRNHAA SLGSYATDGC GEFTFDDTSP SAASSLQCAA  60
CGCHRNFHRK ITAIVRENAA VTMSDQVMEY SGGGGSGGDG RRKRYRTKFT ADQKEKMLGF  120
AEKLGWKLQR KELDEEIERF CESVGVSRQV FKVWMHNHKN SCFANSSDPS TGNANSSLTQ  180
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A3e-231021611775ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1602420.0AC160242.15 Medicago truncatula chromosome 6 clone mth2-65g16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013452758.11e-107zinc finger homeodomain protein
SwissprotA2XLF45e-41ZHD11_ORYSI; Zinc-finger homeodomain protein 11
SwissprotQ10DV55e-41ZHD11_ORYSJ; Zinc-finger homeodomain protein 11
TrEMBLA0A072UBE01e-107A0A072UBE0_MEDTR; Uncharacterized protein
STRINGGLYMA07G12140.21e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF79822844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.13e-39homeobox protein 22