PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA32155
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 164aa    MW: 17800 Da    PI: 6.2613
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA32155genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26025.34.3e-082435899
                     DUF260 58 msslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                               ++sl+yeA  r+ +P +Ga+g+++ +q+  +++ +e +l+++
  Tp57577_TGAC_v2_mRNA32155  2 FKSLLYEAAGRLVNPTHGALGLFWIGQWSRCEATVESVLTGS 43
                               79*******************************999988766 PP

Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
VFKSLLYEAA GRLVNPTHGA LGLFWIGQWS RCEATVESVL TGSNINDVTT VDGQTSSGTL  60
IAENHVLPTT SDIRHVARGT NVDIKEKTQF KRAESIFKPK PRVGWADNAT LLKSILENGS  120
LKIVEASSMI EKELNGAAET QVNFELTLGF NCQSSNDKKS YDN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013452375.13e-75LOB domain protein
TrEMBLA0A072UBI43e-75A0A072UBI4_MEDTR; LOB domain protein
STRINGGLYMA20G24950.12e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14785614
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68510.13e-17LOB domain-containing protein 42