PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA3200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ARR-B
Protein Properties Length: 652aa    MW: 71498.1 Da    PI: 6.8263
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA3200genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.46.8e-28198251155
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               kpr++W+ eLH++Fv av+qL G+ekA+Pk+il++m+v+ +t+e+v+SHLQkYRl
  Tp57577_TGAC_v2_mRNA3200 198 KPRVVWSVELHRKFVAAVNQL-GIEKAVPKKILDMMNVENITRENVASHLQKYRL 251
                               79*******************.********************************8 PP

2Response_reg78.32.7e-26141221109
                               EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTH CS
              Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgee 83 
                               vl vdD+p+ + +l+++l++ +y +v+++++++ al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ 
  Tp57577_TGAC_v2_mRNA3200  14 VLAVDDDPTCLLVLETLLRRCQY-HVTTTSQARTALTMLRENKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSAYGDT 96 
                               799********************.***************888888*******************87754.558************ PP

                               HHHHHHHHTTESEEEESS--HHHHHH CS
              Response_reg  84 edalealkaGakdflsKpfdpeelvk 109
                               +++ + ++ Ga d+l Kp+  eel +
  Tp57577_TGAC_v2_mRNA3200  97 KLVMKGISHGACDYLLKPVRLEELKN 122
                               ***********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.4E-1651648IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.5E-4311148No hitNo description
SuperFamilySSF521722.28E-3611134IPR011006CheY-like superfamily
SMARTSM004488.2E-3312124IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.30313128IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.4E-2314122IPR001789Signal transduction response regulator, receiver domain
CDDcd001564.24E-2815128No hitNo description
PROSITE profilePS5129410.383195254IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-29195256IPR009057Homeodomain-like
SuperFamilySSF466891.63E-19196255IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-24198251IPR006447Myb domain, plants
PfamPF002491.7E-6200250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MDDSGDRFPI GMRVLAVDDD PTCLLVLETL LRRCQYHVTT TSQARTALTM LRENKDKFDL  60
VISDVHMPDM DGFKLLELVG LEMDLPVIML SAYGDTKLVM KGISHGACDY LLKPVRLEEL  120
KNIWQHVIRK KKSDPKEKNK TSKLDKTTSE SGSGLRSAGA ENSDENGKLT KKRKDQDEDE  180
DEDKENGNDN EDPSAQKKPR VVWSVELHRK FVAAVNQLGI EKAVPKKILD MMNVENITRE  240
NVASHLQKYR LYLKRISCVA NQQASMVAAL GSADQSYLRM GGSGHFHNNA FRSFSPNGII  300
SNLNTPTGLN GHGFSPSGLL QLGQSQSFNN SSNDQLKFQP TITPVNQNIL QGMPMSIGFD  360
HLQNNSSKGV FPVQNLNTDV KPTFPIPNRF PDQIPKVTTS SSHPPSLGIS NNGLMLETHT  420
EGKHGGIGIG YGSSSSSVSS RHSDFSFSML DQGRHSDNWS SVVPLSGIQT NSFPSSDCFR  480
QTAIPPSDNM ASLPLQAGYP GGSLADVHSQ GSVFTNSPEY INGNLPFQGW EDRNQDATYH  540
SNITYGSINS LAPVNGAVVP RGQTTSNSTL HRNLDTKFCD PRQMKHAGFA DLTECSSSRQ  600
PRVNIVSQQK FSNNLGSLEY LASSMMEQEQ DKMKLLGGDF ICDSYSGGVS L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-26194257164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA3200
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0196010.0CU019601.8 M.truncatula DNA sequence from clone MTH2-12A22 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003603312.10.0two-component response regulator ARR12
SwissprotA2X1N21e-135ORR24_ORYSI; Two-component response regulator ORR24
TrEMBLA0A2K3P7Z10.0A0A2K3P7Z1_TRIPR; Two-component response regulator
STRINGAES735630.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-123response regulator 12