PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA31441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family VOZ
Protein Properties Length: 489aa    MW: 54505.4 Da    PI: 6.4547
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA31441genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ356.79.2e-1102454631217
                        VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaa 84 
                                pppsafl+pkcalwdc rpaq  +++q yc s h++la+ eglpg+tp+lrp+gid+kdg+lfaa+ ak+ gkevgip+cegaa
  Tp57577_TGAC_v2_mRNA31441 245 PPPSAFLSPKCALWDCIRPAQ--KQCQGYCCSSHEHLAISEGLPGMTPILRPGGIDVKDGPLFAAVLAKTMGKEVGIPKCEGAA 326
                                89******************8..68*********************************************************** PP

                        VOZ  85 takspwnaaelfdlsll.....egetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpss 163
                                ++k+pwna+ +f + ++            wlffdkprraf+sg rkqrslpdy+grgwhesrkqvmke+gg+krsyymdpqp++
  Tp57577_TGAC_v2_mRNA31441 327 STKAPWNASVFFFFFFFlxxxxXXXXXXXWLFFDKPRRAFDSGTRKQRSLPDYHGRGWHESRKQVMKEHGGQKRSYYMDPQPPN 410
                                *********98766544121113345679*****************************************************98 PP

                        VOZ 164 sfewhlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                                  +whlyeyein+ d +alyrlelklvd+kks+kgkvskdsl+dl++k+g+lta
  Tp57577_TGAC_v2_mRNA31441 411 R-DWHLYEYEINSHDGCALYRLELKLVDKKKSPKGKVSKDSLNDLENKMGKLTA 463
                                5.9*************************************************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MMKGNSKGKY GSSSSSSQKS TKEKEKHLVD KIQGIFTNLQ SARKESRAND IVICEEQMHQ  60
LLREWKAELE SPATSLADGS LGSFTGELAQ LLQEIEEKDD ATSPFTSPVP LKTGLHQNNI  120
SDGNYPFFLE NCFENNQTLD HTFKGSASSL FNSPLNNSDM AQLDFHQFGL NQDMDHNAVG  180
HNSDLIGRFN LYQDQSLGHN TEIKNSESTQ FSFEEGIDCS QFFGDNDTTT FGDNLIPNIL  240
PNICPPPSAF LSPKCALWDC IRPAQKQCQG YCCSSHEHLA ISEGLPGMTP ILRPGGIDVK  300
DGPLFAAVLA KTMGKEVGIP KCEGAASTKA PWNASVFFFF FFFLXXXXXX XXXXXWLFFD  360
KPRRAFDSGT RKQRSLPDYH GRGWHESRKQ VMKEHGGQKR SYYMDPQPPN RDWHLYEYEI  420
NSHDGCALYR LELKLVDKKK SPKGKVSKDS LNDLENKMGK LTAAPLPDNG KSIEGKTDAK  480
SENVGLPA*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA31441
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1716181e-172AC171618.20 Medicago truncatula clone mth2-144n17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505530.10.0transcription factor VOZ1
RefseqXP_004505531.10.0transcription factor VOZ1
RefseqXP_012572680.10.0transcription factor VOZ1
RefseqXP_027191648.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-127VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2K3PFJ70.0A0A2K3PFJ7_TRIPR; Transcription factor VOZ1-like protein
STRINGXP_004505529.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-105vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]