PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA31358
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 220aa    MW: 24181.4 Da    PI: 9.2966
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA31358genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.36.7e-382887362
                     zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                               +++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+s
  Tp57577_TGAC_v2_mRNA31358 28 KENLPCPRCDSTNTKFCYYNNYNYSQPRHFCKGCRRYWTQGGTLRDIPVGGGTRKNAKRS 87
                               6889****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-292485IPR003851Zinc finger, Dof-type
PfamPF027011.8E-322985IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9843185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MPSSDSGESR RSTQPQNRPG PGAPGPEKEN LPCPRCDSTN TKFCYYNNYN YSQPRHFCKG  60
CRRYWTQGGT LRDIPVGGGT RKNAKRSRTQ HIAVTSSSSC SVVSSAPEHH HQYQSMTPIS  120
AXXXXXXXXX XXXXXXXXXX XXXXXXXQQQ HSRELWRIAC FRTGWGFPGM VDGSNIGGVP  180
VVSSNLWQLE GGEGGFVGGG DHYFSWPGLA ISTPVNGLK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7678996e-56JF767899.1 Trifolium alexandrinum microsatellite TaSSR402 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518090.14e-73PREDICTED: dof zinc finger protein DOF3.4
TrEMBLK7K6R94e-73K7K6R9_SOYBN; Uncharacterized protein
STRINGGLYMA02G06970.21e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.13e-41OBF binding protein 1