PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA31237
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family HD-ZIP
Protein Properties Length: 253aa    MW: 28868.3 Da    PI: 8.1368
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA31237genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.6e-1994148256
                                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                rk+ ++tkeq  +Le+ F+ ++++++++++eLA+kl+L +rqV vWFqNrRa+ k
  Tp57577_TGAC_v2_mRNA31237  94 RKKLRLTKEQSAVLEDTFKDHSTLNTKQKQELATKLNLRTRQVEVWFQNRRARTK 148
                                78899************************************************98 PP

2HD-ZIP_I/II117.29.4e-3894182189
                HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekev 84 
                                +kk+rl+keq+++LE++F+ +++L++++K+ela++L+l++rqv+vWFqnrRARtk+kq+E+d+e Lk++y++l+een++Le+e 
  Tp57577_TGAC_v2_mRNA31237  94 RKKLRLTKEQSAVLEDTFKDHSTLNTKQKQELATKLNLRTRQVEVWFQNRRARTKLKQTEVDCEELKKCYETLTEENKMLEEEL 177
                                69********************************************************************************** PP

                HD-ZIP_I/II  85 eeLre 89 
                                +eL++
  Tp57577_TGAC_v2_mRNA31237 178 KELKS 182
                                ***94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-1877148IPR009057Homeodomain-like
SuperFamilySSF466891.63E-1881151IPR009057Homeodomain-like
PROSITE profilePS5007117.70290150IPR001356Homeobox domain
SMARTSM003891.3E-1592154IPR001356Homeobox domain
PfamPF000461.1E-1694148IPR001356Homeobox domain
CDDcd000862.22E-1594151No hitNo description
PROSITE patternPS000270125148IPR017970Homeobox, conserved site
SMARTSM003402.9E-13150193IPR003106Leucine zipper, homeobox-associated
PfamPF021837.3E-8150184IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MNTMSNFDHI SLGLTLRVGS PQNRSINIDQ VATTKIEPND EYVYFHQRAS NSTSVQVSSF  60
SNSCNSIKRE RDHDFINSEQ VHHDDVDENG NSNRKKLRLT KEQSAVLEDT FKDHSTLNTK  120
QKQELATKLN LRTRQVEVWF QNRRARTKLK QTEVDCEELK KCYETLTEEN KMLEEELKEL  180
KSMKTTAEQF NYKPLPVAGL TVCPSCKKIC PGRHGDNDPS HTTALLLSPK AQIQFYTNSK  240
YTFTQSSATI AS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142150RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA31237
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004501488.12e-94homeobox-leucine zipper protein HAT9-like
SwissprotP466049e-51HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A1S2Y9H74e-93A0A1S2Y9H7_CICAR; homeobox-leucine zipper protein HAT9-like
STRINGXP_004501488.17e-94(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-39HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]