PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA30860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 355aa    MW: 38861.1 Da    PI: 8.5628
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA30860genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.72.5e-3843101361
                     zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                + a+kcprCds ntkfCyynnysl+qPr+fCk+CrryWt+GG+lrnvPvGgg+rk++k 
  Tp57577_TGAC_v2_mRNA30860  43 KVAIKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTNGGSLRNVPVGGGCRKKQKF 101
                                5679***************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-244396IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.85446100IPR003851Zinc finger, Dof-type
PfamPF027016.2E-3246100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MMPPNNNTPQ DHDQNKNQQK QQEQVSSSET KKRPSSSTSD EQKVAIKCPR CDSPNTKFCY  60
YNNYSLTQPR HFCKTCRRYW TNGGSLRNVP VGGGCRKKQK FKHSSSQSIL SKYSSSPSLD  120
FHLGGLLPLP LPLPLPFSSK VHHHANHQPF LNNQFSSSFQ LDHSLSSNSL MGLNNLYPFS  180
SSNGNGIFNG ANGMNFMNVN SASAITTNST SLASSIESLS CMNQDLHLKL QQQRLATMFG  240
GGDDNKKDDI NGISSSNVLV SGQVSSIEKP QTILFQNLDI SKTNVPNGGD APMEWLFGNS  300
YSSFMMTPTI TTSSIGGVCI NGDHDHGNNN GWINNGVNAW SDVQQQQQPY TALP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1743608e-75AC174360.8 Medicago truncatula chromosome 8 clone mth2-31a5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003628883.11e-108Dof domain zinc finger protein
TrEMBLG7LIJ31e-108G7LIJ3_MEDTR; Dof domain zinc finger protein
STRINGGLYMA01G02610.21e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.14e-30TARGET OF MONOPTEROS 6