PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA3052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 290aa    MW: 32436.9 Da    PI: 7.703
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA3052genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.44.1e-403797363
                    zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                               +alkcprCds+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  Tp57577_TGAC_v2_mRNA3052 37 PEALKCPRCDSSNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 97
                              6789*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-322592IPR003851Zinc finger, Dof-type
PfamPF027015.8E-343994IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6094094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGMDPSNGQN QQMSNQSLEN MITCSKTQED KKPKPQPEAL KCPRCDSSNT KFCYYNNYSL  60
SQPRYFCKSC RRYWTKGGTL RNVPVGGGCR KNKRSSSTSK RTQDQTFPTN PNNPLTCFPS  120
LSYDSNDLTL ALARLQKGHL GFEHEHDFSS ILGNHTNINT NTSCAILNNH GMNNSSNNHG  180
FFEALMGSQN NVQNLYYNTG EVDNGNANGE MMLPYDHEMS IATTQAVTVT TMKQEMCNVR  240
EQNENRVLLG FPWQFNNSDT NMAEIDHSGR GGWNGLNSSW HGLLNSPLM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1492680.0AC149268.21 Medicago truncatula clone mth2-94j16, complete sequence.
GenBankAC1376680.0AC137668.18 Medicago truncatula clone mth2-5f8, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505949.11e-166PREDICTED: dof zinc finger protein DOF2.1
TrEMBLQ76KV21e-162Q76KV2_PEA; DNA binding with one finger 2 protein
STRINGGLYMA12G07710.11e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50263051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.17e-46Dof family protein