PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA30331
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 186aa    MW: 21748.9 Da    PI: 8.827
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA30331genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260114.56.8e-3613111199
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                aCaaCk++r+kC+++C+lapyfp++++k+f++vhk+FG+sn++kl+++++e +r+++++sl++eA  r++dP++G++g + k+ 
  Tp57577_TGAC_v2_mRNA30331  13 ACAACKHQRKKCSENCILAPYFPSNKSKEFKAVHKVFGVSNITKLVRNAQEVDRRRVVDSLIWEAISRQKDPINGSYGEYIKVC 96 
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallke 99 
                                +++++  +el++ +e
  Tp57577_TGAC_v2_mRNA30331  97 NEYKKIFEELKMFRE 111
                                *****9999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.62312113IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3313110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MQRNINNNGM HQACAACKHQ RKKCSENCIL APYFPSNKSK EFKAVHKVFG VSNITKLVRN  60
AQEVDRRRVV DSLIWEAISR QKDPINGSYG EYIKVCNEYK KIFEELKMFR EHQNQLLQMP  120
PHHENKNGIM DSTTIYNSYC SNYLQDLESL RTEVVIPIQQ HSQSYYITGT NLIHHIFINF  180
IYLCF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1400341e-117AC140034.14 Medicago truncatula clone mth2-17g19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505626.11e-82PREDICTED: LOB domain-containing protein 2-like
SwissprotQ9LNB93e-42LBD2_ARATH; LOB domain-containing protein 2
TrEMBLG8A0481e-99G8A048_MEDTR; Putative uncharacterized protein (Fragment)
STRINGGLYMA12G14101.13e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127222534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-43LOB domain-containing protein 2