PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA30042
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 292aa    MW: 32619.2 Da    PI: 8.4588
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA30042genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.15.2e-354199261
                     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                               +++ ++cprCdstntkfCyynny+ sqPr+fC+aC+r+WtkGG+lrnvPvGg  rknk++
  Tp57577_TGAC_v2_mRNA30042 41 QSEVVNCPRCDSTNTKFCYYNNYNKSQPRHFCRACKRHWTKGGTLRNVPVGG-VRKNKRV 99
                               56889*********************************************97.5666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-184187IPR003851Zinc finger, Dof-type
PfamPF027013.1E-314397IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.7484599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGLSSKQVSS RSVDWNQTLL QDQNLELPKT HPMKKNQQIQ QSEVVNCPRC DSTNTKFCYY  60
NNYNKSQPRH FCRACKRHWT KGGTLRNVPV GGVRKNKRVK KSTSPISIST STKTTISTTT  120
TSITTPTTSN MKNQTSEQKQ NQKNISSSIY DQSVIHPPSF LLPQNLMSIK DQSEGNNNEE  180
FGIGNGMFLS SSMSFTQNQS LIFPFSNSSS LRSSNGYNYG EEFKIMEEST VNNSVMPLPS  240
TSGSGTITQP WEEIPATSTG MDMSNYWSWE DIDSLVSTDL NVPWDDSDIK P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF2217519e-34EF221751.1 Glycine max Dof6 transcription factor (Dof6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003593557.11e-149Dof domain zinc finger protein
TrEMBLG7IPR31e-149G7IPR3_MEDTR; Dof domain zinc finger protein
STRINGGLYMA15G07730.11e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-23DOF zinc finger protein 1