PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA29954
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family GRF
Protein Properties Length: 422aa    MW: 47000 Da    PI: 8.3759
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA29954genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.16.6e-23112154143
                        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrksk 43 
                                d+e+grCrRtDGKkWRCsr+v +++k+CErH+hrgrsr r++k
  Tp57577_TGAC_v2_mRNA29954 112 DPEEGRCRRTDGKKWRCSREVAPNNKYCERHMHRGRSRPRSRK 154
                                79***********************************998876 PP

2QLQ477.9e-176393232
                        QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLl 32
                               +FT  Q+ +L++Q+++yKyL+a++PvP eLl
  Tp57577_TGAC_v2_mRNA29954 63 PFTYVQWKELERQAMIYKYLVASLPVPTELL 93
                               8****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-76298IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.0E-126393IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.586398IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.519112156IPR014977WRC domain
PfamPF088791.2E-18113154IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MSEFHSQDNK KPNNNTSTTS VLGSDMMLQH QNHHHRLFSS DHDDSSAIPD VTAVGMAASS  60
GNPFTYVQWK ELERQAMIYK YLVASLPVPT ELLSLDPSFN KKSSSRNKSN NDPEEGRCRR  120
TDGKKWRCSR EVAPNNKYCE RHMHRGRSRP RSRKHVELHT NDNSHNQIKK TVAMPNSIIR  180
TYGGSSSHFH ASTCFQPYQQ TFLCLENNGF VIKTQSFDFS NKQPRGLEWM QNGDPIYLGA  240
SNSGWHSLMH NNRLGLTNES SYQNNTEFQY MNSFPLYTTS KLSQQEKPFS LFFNPLTVPM  300
QTLQYEKPRD FSFIDAWSNA ETVENNANTN RNVSATSIGN FSLSSLDLPM GGPLGEVLRQ  360
SSVTSISDAT NSNPCSPVGI NHVESIGTSA TGMFSSPSGV LHLSDSSGNS TPTIASSKGQ  420
F*
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA29954
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602338.11e-145growth-regulating factor 3 isoform X1
TrEMBLA0A2K3P0V40.0A0A2K3P0V4_TRIPR; Growth-regulating factor
STRINGAES725891e-145(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.18e-34growth-regulating factor 7