PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA29943
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family M-type_MADS
Protein Properties Length: 363aa    MW: 41489.1 Da    PI: 4.5102
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA29943genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF23.66.8e-081154144
                               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                               k+i++   r+  f +R++g+ KK +E S   ++e+++i+f  +g
  Tp57577_TGAC_v2_mRNA29943 11 KQIQDAKVRKAAFMQRKKGLTKKVSEFSNSFGVEACLIVFDGDG 54
                               67999999*******************************97765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.0014162IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.727363IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-13580IPR002100Transcription factor, MADS-box
PfamPF003198.4E-111361IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGRGSGKVTL KQIQDAKVRK AAFMQRKKGL TKKVSEFSNS FGVEACLIVF DGDGDGKPIT  60
WPQDYKTLQS MLTKYEQQKF ETTPKDFKVK DYFANKKNMA ELEILRVRKK IAMKKHPTWG  120
RCFYNLDREE LQGFIDMVDI KIEACNRRIN VLKNTGHIPE EVASPQSSQP KKPIINISEM  180
ADFTDLIEWT DPMPQENAFS SHSSQPMKPI IDISEMEDFT DLIEWNDLMP QENAFSSHSS  240
QLDVMDIIPQ MQPDPAPLQP HDNISLSPVS STDQLGEFGK MYDLMDQSDQ EWVATQFDFD  300
DSAANKLNDG DGDGWMKQPD MFQWNDISFL SEIEQECAAL XXXXXXXXXX XXXXXXLILL  360
FI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA29943
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3LQC50.0A0A2K3LQC5_TRIPR; MADS-box transcription factor (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.15e-13M-type_MADS family protein