PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA29781
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 382aa    MW: 41281.5 Da    PI: 9.8139
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA29781genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.8e-3964123261
                     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                +e+++kcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk+
  Tp57577_TGAC_v2_mRNA29781  64 HEQNMKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKM 123
                                57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2565118IPR003851Zinc finger, Dof-type
PfamPF027017.1E-3366122IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.30168122IPR003851Zinc finger, Dof-type
PROSITE patternPS01361070106IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MNWLKFLTLL PKLYLSTKKK TMSPDETKTS KSPKDKDNNQ QGSGGGGGKK TCSSSSTSTT  60
KPPHEQNMKC PRCDSPNTKF CYYNNYSLTQ PRHFCKTCRR YWTKGGALRN VPIGGGCRKN  120
KKMRPSSSSS RFSCDNSKDS ASSSELVGGL KFLHSLSSPS MDFHLGTGLP FPRLQLQHQQ  180
NHHNLSPIFN QFSSFGETSS AMNHNNYPAS SNSIAGSAMN FPFSVGNNNN YNGAIQGMSS  240
MNIHSNVASS IESLSSMNQD LHWKLQQQRL SMLFGGGENQ QKENNQTEKP LQPILFQNLE  300
VTKQQDGGNF SVGNSRRESI NGGDTPTEWF FGNSYGSVAA TPTASGGGGG GGHDSGSNWN  360
GGGGGGVHGW SDVQQQYSAL P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003612994.11e-164Dof domain zinc finger protein
TrEMBLG7KGJ71e-164G7KGJ7_MEDTR; Dof domain zinc finger protein
STRINGGLYMA01G02610.21e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.13e-52Dof family protein