PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA28896
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ARR-B
Protein Properties Length: 611aa    MW: 67825 Da    PI: 7.0448
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA28896genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.72.2e-27214267155
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                kpr++W+ eLH++F+ +v+qL G +kA+Pk+i+e+m+v+gLt+e+v+SHLQkYRl
  Tp57577_TGAC_v2_mRNA28896 214 KPRVVWSIELHQQFMAVVNQL-GLDKAVPKKIMEMMNVPGLTRENVASHLQKYRL 267
                                79*******************.********************************8 PP

2Response_reg73.86.9e-25371451109
                                EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTT CS
               Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahge 82 
                                vl+vdD+p+ +++l+++l+   y ev+ ++ +e al ll+e++  +D++l D+ mp+mdG++ll++i  e  +lp+i+++a + 
  Tp57577_TGAC_v2_mRNA28896  37 VLVVDDDPTCLMILERMLRFCLY-EVTKCKRAEVALSLLRENKngFDIVLSDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDG 118
                                89*****************9999.***************999999**********************6654.8*********** PP

                                HHHHHHHHHTTESEEEESS--HHHHHH CS
               Response_reg  83 eedalealkaGakdflsKpfdpeelvk 109
                                ++ + + +  Ga d+l Kp+ +e+l +
  Tp57577_TGAC_v2_mRNA28896 119 KNVVMKGVTHGACDYLIKPVRIEALKN 145
                                ***********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.1E-16613603IPR017053Response regulator B-type, plant
SuperFamilySSF521727.54E-3534158IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23006.2E-4134158No hitNo description
SMARTSM004484.0E-2935147IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.50336151IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.6E-2237145IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.71E-2638150No hitNo description
SuperFamilySSF466892.87E-19211271IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-29211272IPR009057Homeodomain-like
PROSITE profilePS512949.448211270IPR017930Myb domain
TIGRFAMsTIGR015575.1E-23214267IPR006447Myb domain, plants
PfamPF002492.8E-7216266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MKLSHNNKVS MPTSTSTSPL NSGDNFISDQ FPAGLRVLVV DDDPTCLMIL ERMLRFCLYE  60
VTKCKRAEVA LSLLRENKNG FDIVLSDVHM PDMDGFKLLE HIGLEMDLPV IMMSADDGKN  120
VVMKGVTHGA CDYLIKPVRI EALKNIWQHV VRKRTNKWKD VKQSGGLDER DREKKVSSDA  180
DYSSSANEGK SSSKKRRDEE DETDERDDSS TSKKPRVVWS IELHQQFMAV VNQLGLDKAV  240
PKKIMEMMNV PGLTRENVAS HLQKYRLYLR RLSGVSQQQS NLNNPFMNPQ ESIFGATPIN  300
GIDLQTLSTS GHLSPQNLAK LQAAGLFSSE NSKLRFGEGQ LQHMSSIKPT NFLHGIPINM  360
EPKQFANFHQ SAQSFSSTNT RVNASSPKRS PWLMQMAQSQ PRGHMLNENI NSHTTRFPSS  420
SMQPTGANGI SVNSFPLRCT PGSSSSSSKG AFHAEATSGI KESGGFSYDI FNELHQKSNN  480
WCLANTGLSY DASQHANPLQ GSIDVSPPIL GNGGFHSIQQ TRQNRDGMSQ GSLQNVGQHL  540
NTPFVDNSSR VKSERILDTN SEINPFSDQF SQEDLMSAFL NQHEGIGPLE NEFDFDGYSL  600
DNIPVYNRSC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-21210273164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA28896
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1350810.0BT135081.1 Medicago truncatula clone JCVI-FLMt-22G12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003594816.10.0two-component response regulator ARR2
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A2Z6MNF40.0A0A2Z6MNF4_TRISU; Two-component response regulator
STRINGAES650670.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-165response regulator 2
Publications ? help Back to Top
  1. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  2. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  3. Takahashi N,Umeda M
    Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
    Plant Signal Behav, 2014. 9(8): p. e29396
    [PMID:25763620]
  4. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  5. Arnaud D, et al.
    Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(3): p. 543-559
    [PMID:28254779]
  6. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  7. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  8. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  9. Takatsuka H,Higaki T,Umeda M
    Actin Reorganization Triggers Rapid Cell Elongation in Roots.
    Plant Physiol., 2018. 178(3): p. 1130-1141
    [PMID:30185441]