PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA28819
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family WOX
Protein Properties Length: 772aa    MW: 87547.9 Da    PI: 4.6507
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA28819genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox46.18e-1542100255
                                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHH CS
                   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRake 55 
                                r+R+t+ ++q+++Le+ F++  + p +ee++++ ++l     +   +V++WFqNr+a++
  Tp57577_TGAC_v2_mRNA28819  42 RPRWTPRPQQVQILEDIFNSgMMSPPKEEIKKIRERLleygPVGHVNVFYWFQNRKARK 100
                                89*****************99*******************99***************96 PP

2Homeobox53.73.5e-17468528257
                                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                                ++R+++++eq+++Le+ F++  ++p +++++++ ++l     + e++V++WFqNr+ + k+
  Tp57577_TGAC_v2_mRNA28819 468 KPRWNPKPEQIRVLEAIFNSgMMNPPRDDIKKIREQLqeygPIGEANVFYWFQNRKSRSKN 528
                                89*****************99****************99999****************995 PP

3Wus_type_Homeobox94.31.1e-3041101262
          Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRer 62 
                                +r+RWtP+p+Q++iLe++++sG+ +P+keei++i+++L eyG ++  NVfyWFQNrkaR+ 
  Tp57577_TGAC_v2_mRNA28819  41 PRPRWTPRPQQVQILEDIFNSGMMSPPKEEIKKIRERLLEYGPVGHVNVFYWFQNRKARKL 101
                                589********************************************************85 PP

4Wus_type_Homeobox105.14.4e-34467530265
          Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                                +++RW+P+peQi++Le++++sG+ +P+++ i++i+++L+eyG i+++NVfyWFQNrk+R+++k+
  Tp57577_TGAC_v2_mRNA28819 467 PKPRWNPKPEQIRVLEAIFNSGMMNPPRDDIKKIREQLQEYGPIGEANVFYWFQNRKSRSKNKH 530
                                689**********************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-737107IPR009057Homeodomain-like
SuperFamilySSF466891.67E-1037105IPR009057Homeodomain-like
PROSITE profilePS5007110.4338103IPR001356Homeobox domain
SMARTSM003892.4E-540107IPR001356Homeobox domain
PfamPF000461.8E-1242100IPR001356Homeobox domain
CDDcd000860.0037350103No hitNo description
SuperFamilySSF466898.98E-12463531IPR009057Homeodomain-like
PROSITE profilePS5007110.932464529IPR001356Homeobox domain
SMARTSM003892.2E-9466533IPR001356Homeobox domain
CDDcd000863.38E-8467530No hitNo description
PfamPF000461.1E-14468527IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.8E-7468528IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 772 aa     Download sequence    Send to blast
MVSSNKHWPS MFKRPNYENS QHRVNSFLTG VHKEERTSQP PRPRWTPRPQ QVQILEDIFN  60
SGMMSPPKEE IKKIRERLLE YGPVGHVNVF YWFQNRKARK LKQTKPKNMN PRKRKSKKTQ  120
NASSSSSPHA SSNEIVVPNN IELPTTNNEV VNLTNDSPND TIFGDQNLGI DDFDIPIETD  180
FLLSTPPLFS FPSEFSNMTQ QLPQQNVDVN PNLLNHEIFM NCANGIPMNE QYDQGNIQDH  240
EAAMNIMQQQ EEDPQLMSLC VTSNLLNDDD IALPPLPPII IDAPVVDPFS ITQFQGVTSN  300
FSLNDDSTLP SIVIDAPDTD PFSITQFQDV GEPDHFMAKC TVSINNYIID VDVGPFNIRQ  360
IFGDEAILVD SSGQLVLTDE WGVTLESLQH GGSYFLIRFD QSSWVRRTNI GLACSRSPTI  420
TIRSMASTPH FYPRQRRCPY FVSILFYVKI TTLYYLGCHG DERTPEPKPR WNPKPEQIRV  480
LEAIFNSGMM NPPRDDIKKI REQLQEYGPI GEANVFYWFQ NRKSRSKNKH RNFAKRKNKN  540
SVPPNNNSII SAQTITNDNV SGNQNLATDY FHTPIETNFQ LSTPPLFSFP NQFSNMTQQL  600
PQQNVDVPNL LNHEILIPMN EQYDQGNIQD HEATMNIMQQ LQEDPQLISL GVTSNSLNDD  660
STLPPLPPIV DAPFTDPFSI TQLQGVGEAD DFSKKCIVSI NNQIFKVDVG PFNICQNFGN  720
QAVLVDSSGQ TILTDEWGMT LDSLQHGASY YLENETNVGD EDDEDDEVQK K*
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA28819
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024626123.13e-87WUSCHEL-related homeobox 9
TrEMBLA0A2K3LFX80.0A0A2K3LFX8_TRIPR; WUSCHEL-related homeobox 9-like protein (Fragment)
STRINGAES781363e-85(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45980.16e-43WUSCHEL related homeobox 8