PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA28815
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family VOZ
Protein Properties Length: 477aa    MW: 53038.6 Da    PI: 5.683
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA28815genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ441.97.9e-1362004161217
                        VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaa 84 
                                pppsaflgpkcalwdc+rpaqg +w+qdycssfha+lalneg+pg++pvlrp+gi+lkd+llf+alsak+qgk+vgipecegaa
  Tp57577_TGAC_v2_mRNA28815 200 PPPSAFLGPKCALWDCPRPAQGLDWCQDYCSSFHAALALNEGPPGMAPVLRPGGIGLKDNLLFSALSAKAQGKDVGIPECEGAA 283
                                89********************************************************************************** PP

                        VOZ  85 takspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewh 168
                                takspwna+elfdls+legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqv++efgglkrsyymdpqp+++fewh
  Tp57577_TGAC_v2_mRNA28815 284 TAKSPWNAPELFDLSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVINEFGGLKRSYYMDPQPLNHFEWH 367
                                ************************************************************************************ PP

                        VOZ 169 lyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                                lyeyei+++da+alyrlelklvd+kk++k+k+++ds+adlqk++++l+a
  Tp57577_TGAC_v2_mRNA28815 368 LYEYEISKCDACALYRLELKLVDGKKNSKAKLTNDSVADLQKQMVKLSA 416
                                ***********************************************87 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MKKNSKSSCK SASHRLFKDK AKNRVDDLQL MFLDLQFARK ESRTVDAAVL EEQVHQMLRE  60
WKSELNEPSP ASSLQQDGSL GSFSTDICRL LQLCEEEDDA SSPLAAPKPE PNDQTLQTGG  120
KVVFQEGQQQ HDFALVDERK QSTSGIQNVA TINQDGPALE YPQFDLHQDF DHGLYTGFNG  180
TVYSEEAIPH ISSYLPSACP PPSAFLGPKC ALWDCPRPAQ GLDWCQDYCS SFHAALALNE  240
GPPGMAPVLR PGGIGLKDNL LFSALSAKAQ GKDVGIPECE GAATAKSPWN APELFDLSVL  300
EGETIREWLF FDKPRRAFES GNRKQRSLPD YSGRGWHESR KQVINEFGGL KRSYYMDPQP  360
LNHFEWHLYE YEISKCDACA LYRLELKLVD GKKNSKAKLT NDSVADLQKQ MVKLSAEFPP  420
DNRRPAKGRA KINAKVGMGA VYSASNRVTP LNGTYEYGLT APYDYLVENM GDYYGT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA28815
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1660920.0AC166092.4 Glycine max cultivar Williams 82 clone gmw1-93l19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012572592.10.0transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1S3E9T90.0A0A1S3E9T9_CICAR; transcription factor VOZ1
STRINGGLYMA07G32374.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]