PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA28813
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 298aa    MW: 34262.5 Da    PI: 8.2887
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA28813genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260107.31.2e-33241231100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                aCaaC+++r+kC++dC+lapyfp ++ ++++ +h++FG snv+k++++l e+er++am+s+ +eA+++ +dP+ G +g +++  
  Tp57577_TGAC_v2_mRNA28813  24 ACAACRHQRKKCKRDCILAPYFPINKLQEYEEAHRVFGYSNVTKMVQNLGEQERQNAMNSIKWEAKMWNQDPIFGPFGAYNDAC 107
                                7******************************************************************************99999 PP

                     DUF260  85 qqleqlkaelallkee 100
                                + + +l + l++++e+
  Tp57577_TGAC_v2_mRNA28813 108 KTITHLWNLLQQQQEQ 123
                                9988877766666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.41323124IPR004883Lateral organ boundaries, LOB
PfamPF031956.1E-3124118IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
LQQKKRKKKQ RVLSSQERMA NRPACAACRH QRKKCKRDCI LAPYFPINKL QEYEEAHRVF  60
GYSNVTKMVQ NLGEQERQNA MNSIKWEAKM WNQDPIFGPF GAYNDACKTI THLWNLLQQQ  120
QEQAHQRVST SEPNKFMGQA QVSLPFNNEA LQVSNNVNWA HFDSPYVASN NVVQNNPNFE  180
YPYVNYFGDS LQIQEPNVLK CVPSGNVVQP SQSNYLQSVA SSSGTNVTMD QYFHYCDENI  240
VTNEEMGMQG DGQGHYGIHT MAHNRVRSQI TEIQHPIHHP FGHSKIFFLL FLHVVEN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
137KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013456911.14e-78LOB domain protein
TrEMBLA0A072UMQ14e-78A0A072UMQ1_MEDTR; LOB domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF147861315
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-27LOB domain-containing protein 2