PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA28478
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ARR-B
Protein Properties Length: 560aa    MW: 62474.8 Da    PI: 6.6262
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA28478genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.85.1e-28319373156
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                k +++WtpeLH++Fv+aveqL G+++A+P++ilelmkv+gLt+++v+SHLQkYR++
  Tp57577_TGAC_v2_mRNA28478 319 KMKVDWTPELHKKFVKAVEQL-GIDQAIPSRILELMKVEGLTRHNVASHLQKYRMH 373
                                5689*****************.********************************96 PP

2Response_reg26.92.5e-10291342109
                                EEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHH..HHHHESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTT CS
               Response_reg   2 livdDeplvrellrqalekegyeevaeaddgeealell..kekdpDlillDiempg.mdGlellkeireeepklpiivvtahge 82 
                                l+ + +++ ++ +r  le+ +y +v ++ +  eal  +    kd+++ ++ ++++    G+++l++     ++lp i+ + +  
  Tp57577_TGAC_v2_mRNA28478  29 LLLQGDNNSASEIRAKLESMDY-NVSTFYNENEALSAIssSSKDFHVAVVEVSISCpHGGFKFLENA----KDLPTIMTSNSRC 107
                                5555566777889999******.***************544555*********99977888887653....4799999999999 PP

                                HHHHHHHHHTTESEEEESS--HHHHHH CS
               Response_reg  83 eedalealkaGakdflsKpfdpeelvk 109
                                 +++ +++ +Ga +fl+Kp ++++l +
  Tp57577_TGAC_v2_mRNA28478 108 INTMMKCIALGAVEFLTKPLSEDKLKN 134
                                ***********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23007.4E-1524155No hitNo description
SuperFamilySSF521722.7E-1324143IPR011006CheY-like superfamily
PROSITE profilePS5011019.36327140IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.8E-832134IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.65E-841139No hitNo description
PROSITE profilePS5129415.341316375IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-27317376IPR009057Homeodomain-like
SuperFamilySSF466892.42E-18318376IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-25319374IPR006447Myb domain, plants
PfamPF002494.8E-8322371IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
LKKDAKPAMV CTANDLQGWK DFPKGLRVLL LQGDNNSASE IRAKLESMDY NVSTFYNENE  60
ALSAISSSSK DFHVAVVEVS ISCPHGGFKF LENAKDLPTI MTSNSRCINT MMKCIALGAV  120
EFLTKPLSED KLKNIWQHVV HKAFNAESSA MSESLKPVKE SVESMLQLET DNKLHESTIL  180
IDLENVSKSS DDEHEHSAAS DKYPAPSTPQ LKQGARLVDD GDCHEQTNCS IEKESGEHDG  240
GECKFVETSC ENVNAESSPQ PTKPLIKEED DFANGSKGES SVLTNPQSKK LLGDTGVNAS  300
PNETSGPKDS CEIKANRKKM KVDWTPELHK KFVKAVEQLG IDQAIPSRIL ELMKVEGLTR  360
HNVASHLQKY RMHKRQIMHT DEDKKWPKQR DTMQRNYCMQ RPIMAYPPYH SNHTYPPAPV  420
YPMWGQPGSQ TAGVPIWAPP GYPLWQQPTE SWHWNPYPGV HVDAWGNPML PLPQPPCVPY  480
TQNITGLHNA KAVDYRFGMP QNSFDHYPAE EMVDKVVKEA ITKPWLPLPI GLKPPSMDSV  540
LDELTKQGIP FSKSKASKH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A6e-17324373655Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA28478
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1445161e-136AC144516.5 Medicago truncatula clone mth2-28p22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024640323.10.0two-component response regulator-like APRR2 isoform X2
SwissprotQ6LA431e-135APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A2K3PF460.0A0A2K3PF46_TRIPR; Two-component response regulator APRR2-like protein
STRINGAES943980.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35663465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-134ARR-B family protein
Publications ? help Back to Top
  1. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]