PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA26993
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CPP
Protein Properties Length: 313aa    MW: 33525.9 Da    PI: 7.6505
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA26993genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR31.43.8e-10222260341
                        TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                                +k C+C+kskCl   C Cf     Cs +CkC dC N+ +
  Tp57577_TGAC_v2_mRNA26993 222 EKICQCRKSKCLSHICPCFGGLGSCSINCKCIDCLNDGN 260
                                578*********************************876 PP

2TCR31.92.7e-10272307439
                        TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                                 gC+C+k++C+ k C+Cf++g+ Cs  C+C++C+N 
  Tp57577_TGAC_v2_mRNA26993 272 IGCSCSKTSCKMKKCSCFKEGVGCSLICTCQGCENI 307
                                69*********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011140.17115158IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.6E-4121155IPR005172CRC domain
SMARTSM011142.0E-6220261IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163417.528221309IPR005172CRC domain
PfamPF036381.4E-7223258IPR005172CRC domain
SMARTSM011141.1E-4269310IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.0E-7273306IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MAASEKKDIP NVSNLEQEKE KIMDAENKNL SFSNTEEEDN SLLPNLNNDP ESAIPNLNDP  60
VVPASRKRHF DLNYPPSDDN DGRKKVNLSS ESKSPSSASS LQFSVSQQNL PSQVQASTGI  120
SCGCMVLGCG SVGCPCYKVN VRCSSRCECR NCENKGVQLS STSLLPSSRQ GHSPSQVQVP  180
ASTERHLGPS AIGVQATKED FGHSLTLQIA RENFGQSTAK VEKICQCRKS KCLSHICPCF  240
GGLGSCSINC KCIDCLNDGN HEDLVLQARM AIGCSCSKTS CKMKKCSCFK EGVGCSLICT  300
CQGCENIHGR KG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA26993
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3LQY91e-159A0A2K3LQY9_TRIPR; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.18e-09TESMIN/TSO1-like CXC 2