PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA26615
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 253aa    MW: 27623.5 Da    PI: 7.8472
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA26615genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.57.2e-41611601100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll ++pe +r da++s+vyeA+ r+rdPvyG++g i++lq
  Tp57577_TGAC_v2_mRNA26615  61 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKLLLEVPEGQRADAANSMVYEANLRLRDPVYGCMGAISTLQ 144
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                qq+++l+ael+++++e
  Tp57577_TGAC_v2_mRNA26615 145 QQVQSLQAELHAIRAE 160
                                ***********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.16160161IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-4161158IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MFGCPETGQE YYLTFFLFFL FVKERLDEIA KINSEGETSS QMGRKHIHGQ VIGTTLNTVT  60
PCAACKLLRR RCAEECPFSP YFSPHEPHKF AAVHKVFGAS NVSKLLLEVP EGQRADAANS  120
MVYEANLRLR DPVYGCMGAI STLQQQVQSL QAELHAIRAE ILKYKYREAA SFISSQQVSI  180
PTNANSQGLS QPLVLPTLDP PSPSLPPPQK VLASQSIILS SLSSSSGSSV YTTSKSTMSH  240
GSISSENIPY FI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1438890.0BT143889.1 Medicago truncatula clone JCVI-FLMt-13L16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003615999.11e-117LOB domain protein
SwissprotQ9AT613e-72LBD13_ARATH; LOB domain-containing protein 13
TrEMBLG7KFM61e-117G7KFM6_MEDTR; LOB domain protein
STRINGGLYMA14G38280.21e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.13e-73LOB domain-containing protein 13