PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA25077
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 236aa    MW: 25871.5 Da    PI: 8.8609
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA25077genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-393696262
                     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                               ++++lkcprC+s+ntkfCyynny+lsqPr+fCk+C+ryWtkGG+lrn+PvGgg+rk  k+s
  Tp57577_TGAC_v2_mRNA25077 36 EQEQLKCPRCESNNTKFCYYNNYNLSQPRHFCKNCKRYWTKGGSLRNIPVGGGTRKVTKRS 96
                               57899***************************************************88776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-263188IPR003851Zinc finger, Dof-type
PfamPF027019.4E-333894IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6864094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
LKVEISTEKQ LKFLSLSHIK MQDPTTFQPM KPNFPEQEQL KCPRCESNNT KFCYYNNYNL  60
SQPRHFCKNC KRYWTKGGSL RNIPVGGGTR KVTKRSSNSK RSTTTTTTPS SSSSAQVSSV  120
SESDPTQIKN NPVEENQRVF GGGSFSSLLA SSERFGNLFE GLNSNGSGLK MVQMGEFGEN  180
LNCDPVGNSG HNNPSGRDGE SEIFHGLQNG GNSSCWNGNH GWSDLAIYTP SSSYQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013444275.11e-113Dof domain zinc finger protein
SwissprotO821552e-44DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLG8A2U01e-113G8A2U0_MEDTR; Dof domain zinc finger protein
STRINGGLYMA07G01461.19e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61813351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.14e-36DOF zinc finger protein 1