PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA24680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family GRAS
Protein Properties Length: 465aa    MW: 52193.1 Da    PI: 5.8173
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA24680genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS310.53.9e-95534612373
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetsekn...sseelaa 80 
                                ++lL++cA+a++++d +laq++L+ l+++a +dgd++qRla  f++AL +r a+  +++ l++++ +++ +  n   +++++++
  Tp57577_TGAC_v2_mRNA24680  53 EQLLVHCANAIETNDVTLAQQILWVLNNIAPQDGDSNQRLAYSFLRALTNRAAKtgTCKMLVEQVYSNAHN--NltiETHRFSV 134
                                79***************************************************933333344444333333..34466666666 PP

                       GRAS  81 lkl..fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg......ske 156
                                 +l  f++++P+++f++ +aN aIlea+eg + +Hi+D++ ++++Q p+L++a+a+R e pp +++T+ ++ ++          
  Tp57577_TGAC_v2_mRNA24680 135 IELanFVDLTPWHRFGYAAANAAILEATEGFSVIHIVDLSSTHCMQIPTLIDAIANRHEVPPLIKLTVSDHDNNIdqippkLDL 218
                                66699*****************************************************************98877899976677 PP

                       GRAS 157 eleetgerLakfAeelgvpfefnvl...vakrledleleeLrvkp....gEalaVnlvlqlhrll................... 214
                                +++e+g++L +fA++ +v++ef+v+   +++ +++l +e+Lrv++    gEal++n++++lh+++                   
  Tp57577_TGAC_v2_mRNA24680 219 SYQELGSKLVNFARSRNVTLEFRVVsssYTNGFASL-IEHLRVQHmvysGEALVINCHMMLHYIPdetlsnsnsyvydsmsssv 301
                                89**********************955544444455.888888888888*********************************** PP

                       GRAS 215 ...desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                                     +++++s r+ +L ++++l P++v++v++++d++s+++++r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+
  Tp57577_TGAC_v2_mRNA24680 302 sttTTTATTTSLRSLFLTALRGLDPTLVILVDEDVDLTSNNLVNRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIE 384
                                *9977788888899***************************************************************.****** PP

                       GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                n++a+eg +r+er e  +kW++r+++a F+ + ++e+ + ++k++l +++  g+ +++e++++vl+Wk++++v++SaW
  Tp57577_TGAC_v2_mRNA24680 385 NLIAHEGVQRVERDEPIGKWEQRMRNANFQGIGFGEECVGEVKAMLDEHA-AGWGLKKEDECIVLTWKGHNVVFASAW 461
                                **************************************************.99************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.27826443IPR005202Transcription factor GRAS
PfamPF035141.3E-9253461IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MTQFTPSLPY LHQTTTTFSN PSSSMNKNNQ IPTKPWFPTS KALTTFGDTN CMEQLLVHCA  60
NAIETNDVTL AQQILWVLNN IAPQDGDSNQ RLAYSFLRAL TNRAAKTGTC KMLVEQVYSN  120
AHNNLTIETH RFSVIELANF VDLTPWHRFG YAAANAAILE ATEGFSVIHI VDLSSTHCMQ  180
IPTLIDAIAN RHEVPPLIKL TVSDHDNNID QIPPKLDLSY QELGSKLVNF ARSRNVTLEF  240
RVVSSSYTNG FASLIEHLRV QHMVYSGEAL VINCHMMLHY IPDETLSNSN SYVYDSMSSS  300
VSTTTTTATT TSLRSLFLTA LRGLDPTLVI LVDEDVDLTS NNLVNRLRSA FNYLWIPYDT  360
VDTFLPRGSK QRQWYEADIC WKIENLIAHE GVQRVERDEP IGKWEQRMRN ANFQGIGFGE  420
ECVGEVKAML DEHAAGWGLK KEDECIVLTW KGHNVVFASA WLPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B3e-515346388474Protein SHORT-ROOT
5b3h_B8e-525346334420Protein SHORT-ROOT
5b3h_E8e-525346334420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA24680
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1377030.0AC137703.43 Medicago truncatula chromosome 8 clone mth2-11d24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024638779.10.0scarecrow-like protein 32
SwissprotQ9SN221e-172SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A2K3ND570.0A0A2K3ND57_TRIPR; SCARECROW-like protein 32-like
STRINGAES906730.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-162GRAS family protein