PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA24544
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 225aa    MW: 24864.1 Da    PI: 8.374
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA24544genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.47.6e-41181171100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++ e  r da++slvyeA++r+rdPvyG++g i++lq
  Tp57577_TGAC_v2_mRNA24544  18 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVAECSRADAANSLVYEANVRLRDPVYGCMGAISTLQ 101
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                qq+++l+ael++l++e
  Tp57577_TGAC_v2_mRNA24544 102 QQVQSLQAELNVLRSE 117
                                ***********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.98217118IPR004883Lateral organ boundaries, LOB
PfamPF031959.7E-4118115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGRRHMLGPP GTLNTITPCA ACKLLRRRCA QECPFSPYFS PHEPQKFASV HKVFGASNVS  60
KMLMEVAECS RADAANSLVY EANVRLRDPV YGCMGAISTL QQQVQSLQAE LNVLRSEILK  120
YKLREAANIN MNNMNMNNML QASSHHHVPM LPSNSSVAVS IAAPPPPPPX XXXXXXXXXX  180
XXXXXXXXXX LPPTSNSSSS IYFQERDHNN YSTISSDDNI SYFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132573e-39LN713257.1 Cucumis melo genomic chromosome, chr_3.
GenBankLN6818213e-39LN681821.1 Cucumis melo genomic scaffold, anchoredscaffold00040.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602464.11e-103fission regulator
SwissprotQ9AT613e-71LBD13_ARATH; LOB domain-containing protein 13
TrEMBLG7J9S31e-103G7J9S3_MEDTR; Fission regulator
STRINGGLYMA06G15050.11e-94(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-71LOB domain-containing protein 15