PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA24508
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family M-type_MADS
Protein Properties Length: 327aa    MW: 37418 Da    PI: 4.6373
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA24508genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF25.91.3e-081159149
                               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                               k i+n+  r+  f +R +g+ KK +E S+  ++e+++i++  +gk   +
  Tp57577_TGAC_v2_mRNA24508 11 KNIQNEKVRNSAFNQRSKGLTKKVSEFSTNFEVEACLIVYDGDGKPMIW 59
                               689*************************************999986655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.9E-4162IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.797355IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-15581IPR002100Transcription factor, MADS-box
PfamPF003192.8E-101357IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MGRGSGKVTL KNIQNEKVRN SAFNQRSKGL TKKVSEFSTN FEVEACLIVY DGDGKPMIWP  60
QDSTTLHMLT KYEQQKNETT LKKFEVKDYF ANKKNAAEAE ILRVRKKITK NKYPTWGRCF  120
NNLEGEQLKG FLNFVDLKIQ CCNERINILK NMEQSYQTSF RENTAHMPEY VTSPQASQPN  180
DTLKQLVSIN DMMDFTDIIE WDDLMPQNNG FSSHSSEINV MHSIPQIQPI SAPLKSVDNI  240
SLPSTSSTNQ LGEFVKLDDL MDKSEQDWAS QLVDLDDWDA NKLDDDGIVN WLRQPDVFEW  300
QDISFSSEIE QQCAALDVFS QSIYGF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA24508
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2Z6P1V21e-116A0A2Z6P1V2_TRISU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.13e-14AGAMOUS-like 82