PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA24278
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CPP
Protein Properties Length: 621aa    MW: 66805.3 Da    PI: 8.0182
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA24278genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.91.1e-14118156241
                        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                                ++k+CnCk+s+Clk+YCeCfa+g +C+  C+C +C+N+ +
  Tp57577_TGAC_v2_mRNA24278 118 KQKQCNCKHSRCLKLYCECFASGIYCDG-CNCVNCFNNVD 156
                                89**************************.********986 PP

2TCR50.83.3e-16195234140
                        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Tp57577_TGAC_v2_mRNA24278 195 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 234
                                589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.3E-17117157IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.129118235IPR005172CRC domain
PfamPF036383.1E-11119154IPR005172CRC domain
SMARTSM011148.4E-20195236IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12198233IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MFVLLKNFKE FRFSSFLRFS SVSFSVSVSL FRMSEGENSD ITPKNVPLDS VANSTSKKLA  60
RQLDFNAFGG APVTAPLPEQ QQPPPTLPPL PAAKLGKPES PKSKSRSNFE TKDATPKKQK  120
QCNCKHSRCL KLYCECFASG IYCDGCNCVN CFNNVDNEAA RREAVEATLE RNPNAFRPKI  180
ASSPHGREEV LILGKHNKGC HCKKSGCLKK YCECFQANIL CSENCKCMDC KNFEGSEERQ  240
ALFHGDQNNN MAYIQQAANA AITGAIGSSG YSSPPVSRKR KGSELWPSIK DPSVSKLGQQ  300
ANPIRGPAAP SSSMSPVPVA RVGPATVGPS KFMYRSLLAD IIQPQHLKEL CSILVLVSGQ  360
ATKTLTEQKN LKDKHAEDQT ETSLASSNQE QLPNQKEANV EKAMADDCSS ATQTDKTSPE  420
NSSSDGADVP KGRPMSPGTL ALMCDEQDTM FMNAAPSIGS MAHACNTSSQ LPYGQGAKEI  480
YAEQERIVLT KFRDFLNRVI TMGEINETKC SSLARSELEI QKDPIINSTE RASTEAAHQQ  540
GVGATSNGAA NVVGNTTTST SLFPCSLVSE RASTEAAHQQ GVGATSNGAA NVVGNTTTST  600
SLVPSSLVSE KWEIKPKVEQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-311102442132Protein lin-54 homolog
5fd3_B3e-311102442132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA24278
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-131AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003630778.30.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A2K3P6P60.0A0A2K3P6P6_TRIPR; Protein tesmin/TSO1-like CXC 5-like
STRINGXP_004503448.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26263379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-165Tesmin/TSO1-like CXC domain-containing protein