PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA2411
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family GATA
Protein Properties Length: 408aa    MW: 45012.4 Da    PI: 7.5589
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA2411genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.93.4e-19323357135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               Cs+Cg+tkTp+WR gp g ktLCnaCG+++++ +l
  Tp57577_TGAC_v2_mRNA2411 323 CSHCGVTKTPQWRTGPLGAKTLCNACGVRFKSGRL 357
                               *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.19E-14316379No hitNo description
SMARTSM004018.0E-17317371IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.163317353IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.0E-14321355IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.81E-15322370No hitNo description
PfamPF003205.4E-17323357IPR000679Zinc finger, GATA-type
PROSITE patternPS003440323348IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
KERERRKRAL YSNNKFLDTF TPYSMLYQTP YPLLFQFHPL PSSSSFTIPL STISQPQLSL  60
TKASKTEMEC VETALKTSLR KDITPQTFVD ELTVLNAQNG TTSDDFFVDD LLDFSHVEEQ  120
QQDEEQQQQD SVFVSLKQTH EISNLNNSNS NSFSLKNDYA SLPTSDLNVP SDDVADDLEW  180
LSHFVEDSDS FSEFSAVMPV VTLTTTEKTP KGVVVSEPKP KNESPGPVVT TFKTPVQTKA  240
RSKRTRNGVR VWPFGSNTLT ESSSSSTTSS STSSSSPTSP LLIYTNLVQK FDSVPAKKPK  300
KMTGFNGSGH GTVVVAPAAP RRCSHCGVTK TPQWRTGPLG AKTLCNACGV RFKSGRLLPE  360
YRPACSPTFS SELHSNHHRK VLEMRRKKEV VDGVEIETGL SPSPVVD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004512096.11e-169PREDICTED: GATA transcription factor 5
SwissprotQ9FH572e-70GATA5_ARATH; GATA transcription factor 5
TrEMBLG7KGC31e-160G7KGC3_MEDTR; GATA type zinc finger transcription factor family protein
STRINGGLYMA01G37450.11e-120(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.29e-58GATA transcription factor 5