PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA23139
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family SBP
Protein Properties Length: 949aa    MW: 105100 Da    PI: 7.9621
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA23139genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.62.4e-4035112178
                                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                +Cqv++C++dls+ak+yhrrhkvCe+hska+++l+ +++qrfCqqCsrfh l efDe+krsCrrrLa+hn+rrrk+q+
  Tp57577_TGAC_v2_mRNA23139  35 MCQVDNCKEDLSKAKDYHRRHKVCEAHSKASKALLGNQMQRFCQQCSRFHPLLEFDEGKRSCRRRLAGHNRRRRKTQP 112
                                6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.3E-342897IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.68433110IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-3734115IPR004333Transcription factor, SBP-box
PfamPF031101.4E-2936109IPR004333Transcription factor, SBP-box
CDDcd002045.48E-4743833No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 949 aa     Download sequence    Send to blast
LNLGGAAVNG GVNGGVVNRA NKRVRSGSPT ASYPMCQVDN CKEDLSKAKD YHRRHKVCEA  60
HSKASKALLG NQMQRFCQQC SRFHPLLEFD EGKRSCRRRL AGHNRRRRKT QPDEVANSSS  120
PPLNQQVVAA AANLEIFNLL TAIADGSQGK FEERRSQVPD KEQLVQILNR IPLPADLTAK  180
LLDVGNNLKG KNDNVPMQTS SPYHYRDDQP NSVPSAPLTM DLLAVLSTTP STPAQNGGTK  240
STTSADQIRE QQFTSVGGER SSGSSQSPND DSDCQEDVRV NLPLQLFNSS PEDDNRSKLP  300
SSRNYFSSES SNPVDERSPS SSPPVVEMNF GLQGGIRGLN SNSIKTGMGV NANKETSQSH  360
SCTTIPLDLF KGSKSNNMIQ QTSSVQSVPF KAGYASSGSD YSPPSLNSDT QDRTGRIMFK  420
LFDKHPSHLP GTLRSQIYNW LSTRPSDLES YIRPGCVVLS IYATMSSAAW AQLEENFLQR  480
VHSLIHNSDS DLWRNGRFLV YSGSQLASHK DGKIRMCKPW GTWRSPELIS VSPLAIVSGQ  540
ETSMSLKGRN LSAPGTKIHC TGADGYTSSE VIGSEDPGMI YDEIKLGGFK VQNTSPGGAL  600
GRCFIEVENG FKGDCFPVII ADASICKELR PLESEFDEEE KICDAISEEH EYHFGRPKSR  660
DEALHFLNEL GWLFQRERFS NVHEVPDYSL DRFKFVLTFS VERNCCMLVK TLLDILVSKH  720
FEGERLSTRS MEMLKAIQLL NRAVKRKYIS MIDLLIHYCI PSKNDTSTKY IFPPNLEGPG  780
GITPLHLAAS TSDSEGVIDS LTNDPQEIGL KCWETLVDES GQTPHAYAVM RNNYSYNMLV  840
ARKRSDRQRS EVAVRIDNEI QHPLEVELMQ KRINQVKRVA DSCSKCAIAE VRSKRKFSGS  900
RSWLHGPFIH SMLAVAAVCV CVCVLFRGTP FVGSVSPFRW ENLDYGAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3028109384squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA23139
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1407740.0AC140774.7 Medicago truncatula clone mth2-5e11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003589683.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2K3NZ420.0A0A2K3NZ42_TRIPR; Squamosa promoter-binding-like protein 14-like
STRINGAES599340.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]