PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA2262
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YB
Protein Properties Length: 192aa    MW: 21068.4 Da    PI: 8.1948
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA2262genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB180.71.3e-5638133297
                     NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86 
                               +eqdrflPianvsrimk++lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plkvy
  Tp57577_TGAC_v2_mRNA2262  38 KEQDRFLPIANVSRIMKRALPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKVY 122
                               89*********************************************************************************** PP

                     NF-YB  87 lkkyrelegek 97 
                               l++yre+egek
  Tp57577_TGAC_v2_mRNA2262 123 LNNYRETEGEK 133
                               *********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.6E-5433151IPR009072Histone-fold
SuperFamilySSF471131.29E-4040145IPR009072Histone-fold
PfamPF008081.9E-2743107IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-187189No hitNo description
PROSITE patternPS0068507490IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.4E-1890108No hitNo description
PRINTSPR006151.4E-18109127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
LKEKKKSTYF NMAGNKRNQT SPVGSPTSGN ISDSSSSKEQ DRFLPIANVS RIMKRALPAN  60
AKISKEAKET VQECVSEFIS FITGEASDKC QREKRKTING DDLLWAMTTL GFENYVGPLK  120
VYLNNYRETE GEKSNSSSMV TSTKQDDYDL NNSSIDVNHD VVVGVGGGGG GFYSHVIDHA  180
PKRFQEINGA W*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4838128292Transcription factor HapC (Eurofung)
4g92_B1e-4838128292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182801e-178JQ918280.1 Medicago truncatula nuclear transcription factor Y subunit B7 (NF-YB7) mRNA, complete cds.
GenBankAC2024941e-178AC202494.23 Medicago truncatula clone mth2-25j15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003630101.11e-98nuclear transcription factor Y protein
SwissprotO233101e-63NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLG7LB971e-98G7LB97_MEDTR; Nuclear transcription factor Y protein
STRINGGLYMA08G14931.11e-83(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.16e-65nuclear factor Y, subunit B3