PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA22128
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ZF-HD
Protein Properties Length: 86aa    MW: 9329.34 Da    PI: 7.7985
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA22128genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.36.8e-321974359
                ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                                v+Y eC+kNhAa++Gg+avDGC+Efm+s +eegt  al+CaACgCHRnFH+re +e
  Tp57577_TGAC_v2_mRNA22128 19 VVKYGECQKNHAANVGGYAVDGCREFMAS-SEEGTNGALTCAACGCHRNFHKRELVE 74
                               699*************************9.8889*******************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-24183IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.5E-302071IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.6E-262171IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.7142271IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MRKRQVVVRR TEDSSQRSVV KYGECQKNHA ANVGGYAVDG CREFMASSEE GTNGALTCAA  60
CGCHRNFHKR ELVETETVSE CSNGT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1396002e-62AC139600.16 Medicago truncatula chromosome 6 clone mth2-20m4, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014508009.12e-39PREDICTED: mini zinc finger protein 2-like
RefseqXP_012568098.12e-39PREDICTED: mini zinc finger protein 2-like
RefseqXP_004489393.12e-39PREDICTED: mini zinc finger protein 2-like
SwissprotQ9LJW51e-32MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A0L9VPI32e-39A0A0L9VPI3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T8H52e-39A0A0S3T8H5_PHAAN; Uncharacterized protein
STRINGGLYMA13G05380.23e-38(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.18e-34mini zinc finger 2