PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA21663
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family GRAS
Protein Properties Length: 466aa    MW: 52995.4 Da    PI: 5.3931
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA21663genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS277.24.8e-85604622373
                       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.......sseel 78 
                                ++lL++cA+a+++++++laq++L+  +++  +dgd++qRla  f +AL +r ++++s  +  + +++ts++n       +++++
  Tp57577_TGAC_v2_mRNA21663  60 EQLLVHCANAIETNNATLAQQILWVFNNTTPQDGDSNQRLAGSFIRALINRASKTGSCKMLEVVTETTSSYNnhnnlamQIHKF 143
                                79****************************************************544333333333333333355544333333 PP

                       GRAS  79 aalkl.....fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.... 153
                                +   +     f++++P+++f++ +aN++I+ea++g + +Hi+D+++++++Q p+L++++++R+e pp +++T+ +  + +    
  Tp57577_TGAC_v2_mRNA21663 144 S---VieladFVDLTPWHRFGFTAANSTIVEATKGFSVIHIVDLSLTHCMQIPTLIDSISNRDEVPPLIKLTVADFRNMNihmp 224
                                3...255599***************************************************************99977778899 PP

                       GRAS 154 ....skeeleetgerLakfAeelgvpfefnvl...vakrledleleeLrvkp......gEalaVnlvlqlhrlldesvsles.. 222
                                       ++ e+g +L +fA++ +v +ef+++   +a+ +++l +e+Lrv+       +Eal++n+++ lh+++de+++ ++  
  Tp57577_TGAC_v2_mRNA21663 225 ipplLDLSYDELGAKLVNFAKSKNVIMEFKAVsstYADGFASL-IEHLRVQVqhydktHEALVINCHMILHYIPDETLNHTNmn 307
                                998888999**********************866644455555.77776665567779****************9988877666 PP

                       GRAS 223 ......erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
                                       r+ +L++++sl P++vv+v+++ad++s++++ r+ +++++ +  +d +++ lp+ s++r ++E+  + ++i+nv+a 
  Tp57577_TGAC_v2_mRNA21663 308 pnysssLRSMFLEALRSLDPTIVVLVDEDADLTSNDLVCRLKSTFNFLWIPYDIVDTFLPQGSKQREWYEAS-ICWKIENVIAY 390
                                6666667899**************************************************************.*********** PP

                       GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                eg er+er e ++kW++r+++a F+ + ++e+   ++k++l +++  g+ +++e++ +vl+Wk+++++++SaW
  Tp57577_TGAC_v2_mRNA21663 391 EGIERVERVEPKSKWEQRMRNAHFQGICFDEDSILEVKAMLDEHA-VGWGLKKEDEFVVLTWKGNNVIFASAW 462
                                *********************************************.7899*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.97533444IPR005202Transcription factor GRAS
PfamPF035141.7E-8260462IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MTQFTPTFPV FTFSSNQTLF QPYHTMEQQS KQIPITTTPC SEFPTPINSL QNFNKTNCME  60
QLLVHCANAI ETNNATLAQQ ILWVFNNTTP QDGDSNQRLA GSFIRALINR ASKTGSCKML  120
EVVTETTSSY NNHNNLAMQI HKFSVIELAD FVDLTPWHRF GFTAANSTIV EATKGFSVIH  180
IVDLSLTHCM QIPTLIDSIS NRDEVPPLIK LTVADFRNMN IHMPIPPLLD LSYDELGAKL  240
VNFAKSKNVI MEFKAVSSTY ADGFASLIEH LRVQVQHYDK THEALVINCH MILHYIPDET  300
LNHTNMNPNY SSSLRSMFLE ALRSLDPTIV VLVDEDADLT SNDLVCRLKS TFNFLWIPYD  360
IVDTFLPQGS KQREWYEASI CWKIENVIAY EGIERVERVE PKSKWEQRMR NAHFQGICFD  420
EDSILEVKAM LDEHAVGWGL KKEDEFVVLT WKGNNVIFAS AWLPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-416046588475Protein SHORT-ROOT
5b3h_B1e-416046534421Protein SHORT-ROOT
5b3h_E1e-416046534421Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA21663
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003611618.10.0scarecrow-like protein 32
RefseqXP_013459850.10.0scarecrow-like protein 32
SwissprotQ9SN221e-163SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A2K3MVQ30.0A0A2K3MVQ3_TRIPR; SCARECROW-like protein 32-like
STRINGAES945760.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-165GRAS family protein