PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA20908
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 372aa    MW: 43273.8 Da    PI: 8.5865
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA20908genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.22.7e-3842130189
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+kll ++pe++r da++slvyeA++r+rdPvyG++g i++lq
  Tp57577_TGAC_v2_mRNA20908  42 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKLLMEVPENQRADAANSLVYEANVRLRDPVYGCMGAISSLQ 125
                                7*********************************************************************************** PP

                     DUF260  85 qqleq 89 
                                qq+  
  Tp57577_TGAC_v2_mRNA20908 126 QQIXX 130
                                **976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.51841361IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-3842130IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MLILFLYRER LFDEIGKKRE GDDSFQKGRM LGPSGTLNTT TPCAACKLLR RRCAQECPFS  60
PYFSPHEPQK FASVHKVFGA SNVSKLLMEV PENQRADAAN SLVYEANVRL RDPVYGCMGA  120
ISSLQQQIXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  240
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  300
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXDSHNI  360
LPKKYDYCSF S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9387101e-103CR938710.1 Medicago truncatula chromosome 5 clone mth2-170k9, COMPLETE SEQUENCE.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-61LOB domain-containing protein 15