PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA2029
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family SBP
Protein Properties Length: 485aa    MW: 53823.7 Da    PI: 6.5009
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA2029genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.91.2e-42135210277
                               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                       SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                               Cqv gC++dls++k+yh+rhkvCevhsk++ v+v+g+eqrfCqqCsrfh lsefD++krsCr+rLa+hnerrrk+q
  Tp57577_TGAC_v2_mRNA2029 135 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTAIVIVNGIEQRFCQQCSRFHLLSEFDDGKRSCRKRLAGHNERRRKPQ 210
                               **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-32130196IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.633132209IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-39133213IPR004333Transcription factor, SBP-box
PfamPF031101.6E-31135208IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MESWSYISEE KGYVSNENQC SEEMGFCEIL GKQFSDDFNF IGSVSSRKLD DKFGDPNELS  60
VKGETNFKFS NSNSMVESNG WDSLIDLKLG HFGNHGDAIS IGAAFSKGVG STILSSCESS  120
IPPKRVRVHS MTAYCQVYGC NKDLSSCKDY HKRHKVCEVH SKTAIVIVNG IEQRFCQQCS  180
RFHLLSEFDD GKRSCRKRLA GHNERRRKPQ VGVHSANSGR LFQPCGDIIF QATKAPPASF  240
ICPEVLPNGF WRPTKTEHET GFMHLSSVPI TNGHPQQRSS FASYNGKQFP FLHENVATST  300
TGSMFSENNN SHYVHSVGDT YLGSGEFKVF HTSSTVRGLS GASDTCALSL LSSQSKNTSS  360
QSSGIPFDQP LVIPSSHEHL YSIRSQTTSS SQFYDRFPSE LNPPDGNHLS PILISDNNDI  420
VNFEIVDEIF QDSDFVNAKD CLSCEDDATI DLLQLSTQLQ RVEHRRQSFQ LKNESDSSCT  480
LRIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-291352081184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA2029
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013458014.10.0putative squamosa promoter-binding-like protein 19
TrEMBLA0A2K3PM310.0A0A2K3PM31_TRIPR; Squamosa promoter-binding-like protein 6-like
STRINGGLYMA04G32002.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.15e-46SBP family protein