PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA19953
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 306aa    MW: 34400.3 Da    PI: 5.4683
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA19953genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601247.5e-39161151100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn+ k++k l++  +++am++++y++++ra+dPv G+++ i++lq
  Tp57577_TGAC_v2_mRNA19953  16 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNINKIIKYLDPPLKDQAMRTIIYQSDMRANDPVGGCYKYIQDLQ 99 
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                 q+e  k el+l+ ++
  Tp57577_TGAC_v2_mRNA19953 100 AQIEYCKIELDLVLQQ 115
                                *********9998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.40615116IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-3616111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MNNININKNN NNTTQACAAC KYQRRKCAPD CILAPYFPHD RQRQFLNAHK LFGVSNINKI  60
IKYLDPPLKD QAMRTIIYQS DMRANDPVGG CYKYIQDLQA QIEYCKIELD LVLQQLAVYR  120
AQPHQQQPQV VNYGDQVIVN SDSLLGFYNP SGSVVPATAP AHYHYNVQQQ VVTPLQEHEQ  180
EQYLMMHESN SSSINSTTPL QQHINNWGAM QNSISLSSLS LHGQSSNASD EYDHKPTLDI  240
PCDERNELGF DSGEILHHSD ESVLFKIDDG LIKAEGGYIQ ETQAQEQDHD LKGAATLFTL  300
TNCTS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1409150.0AC140915.6 Medicago truncatula chromosome 8 clone mth2-10l24 map 9.500cM, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003627098.11e-164LOB domain protein
TrEMBLG7LHF81e-164G7LHF8_MEDTR; LOB domain protein
STRINGGLYMA07G01170.21e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.14e-57LOB domain-containing protein 22